SecReT6
Protein ID: 54307876
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0673
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]740336..743080 [+]
ProductATPase with chaperone activity
NoteTssH
UniProt IDQ6LUD1
KEGG IDppr:PBPRA0673
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-41, Aligned region: 272..291
AAA_2 [PF07724], Evalue: 2.60E-41, Aligned region: 647..814
AAA_2 [PF07724], Evalue: 2.60E-41, Aligned region: 864..885
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 271..384
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 652..772
AAA_16 [PF13191], Evalue: 5.30E-14, Aligned region: 248..294
AAA_16 [PF13191], Evalue: 5.30E-14, Aligned region: 315..349
AAA_16 [PF13191], Evalue: 5.30E-14, Aligned region: 514..538
AAA_16 [PF13191], Evalue: 5.30E-14, Aligned region: 621..687
AAA_16 [PF13191], Evalue: 5.30E-14, Aligned region: 716..744
AAA_5 [PF07728], Evalue: 3.10E-12, Aligned region: 271..295
AAA_5 [PF07728], Evalue: 3.10E-12, Aligned region: 651..770
AAA_5 [PF07728], Evalue: 3.10E-12, Aligned region: 872..901
ClpB_D2-small [PF10431], Evalue: 7.40E-11, Aligned region: 819..892
Sigma54_activat [PF00158], Evalue: 9.20E-09, Aligned region: 249..286
Sigma54_activat [PF00158], Evalue: 9.20E-09, Aligned region: 649..768
Sigma54_activat [PF00158], Evalue: 9.20E-09, Aligned region: 872..906
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 270..351
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 395..431
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 485..535
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 649..675
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 713..732
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 271..404
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 604..620
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 649..745
AAA_14 [PF13173], Evalue: 1.90E-06, Aligned region: 812..853
AAA_19 [PF13245], Evalue: 2.60E-06, Aligned region: 271..294
AAA_19 [PF13245], Evalue: 2.60E-06, Aligned region: 647..673
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 265..294
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 651..676
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 762..786
Arch_ATPase [PF01637], Evalue: 3.40E-05, Aligned region: 249..285
Arch_ATPase [PF01637], Evalue: 3.40E-05, Aligned region: 324..356
Arch_ATPase [PF01637], Evalue: 3.40E-05, Aligned region: 644..692
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 271..328
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 395..442
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 647..672
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 714..735
T2SE [PF00437], Evalue: 0.0011, Aligned region: 240..288
T2SE [PF00437], Evalue: 0.0011, Aligned region: 646..720
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 271..312
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 650..686
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 271..302
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 652..681
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 265..287
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 647..662
NTPase_1 [PF03266], Evalue: 0.0019, Aligned region: 271..296
NTPase_1 [PF03266], Evalue: 0.0019, Aligned region: 651..690
NACHT [PF05729], Evalue: 0.0031, Aligned region: 271..299
NACHT [PF05729], Evalue: 0.0031, Aligned region: 651..669
TIP49 [PF06068], Evalue: 0.004, Aligned region: 271..297
TIP49 [PF06068], Evalue: 0.004, Aligned region: 321..351
TIP49 [PF06068], Evalue: 0.004, Aligned region: 618..688
Zeta_toxin [PF06414], Evalue: 0.0056, Aligned region: 266..291
Zeta_toxin [PF06414], Evalue: 0.0056, Aligned region: 649..691
DUF258 [PF03193], Evalue: 0.0077, Aligned region: 256..289
DUF258 [PF03193], Evalue: 0.0077, Aligned region: 649..664
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 272..292
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 652..675
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 752..770
DUF815 [PF05673], Evalue: 0.008, Aligned region: 261..347
DUF815 [PF05673], Evalue: 0.008, Aligned region: 645..683
RuvB_N [PF05496], Evalue: 0.0082, Aligned region: 271..293
RuvB_N [PF05496], Evalue: 0.0082, Aligned region: 612..680
RuvB_N [PF05496], Evalue: 0.0082, Aligned region: 719..745
AAA_30 [PF13604], Evalue: 0.0091, Aligned region: 268..294
AAA_30 [PF13604], Evalue: 0.0091, Aligned region: 647..676
UPF0079 [PF02367], Evalue: 0.0094, Aligned region: 271..291
UPF0079 [PF02367], Evalue: 0.0094, Aligned region: 644..680
Protein Sequence: 914 a.a.     [Download]
>gi|54307876|ref|YP_128896.1| ATPase with chaperone activity [Photobacterium profundum SS9]
MASANGLYAFTYRNIKTEHHSVRSKRHAGYSVIARFSVSEYLAKLISVLGWIMSTMTLTSLVDKLTPEAK
RTLELSAALANSRSHSSVEILHWLISIVDAQSSDYVAVSRCFDINDAQLKQDLMVKLERLPTGCDDAPGL
AVHTVNLLRQAWLATTIEFNDNSIGAVHLLYTMLADDSLSSIVGFYSKELGKISPAQLLHVWPELVTKQK
SNAVDQDPHLSAGSQTPALSQFTIDLTEQARNGDIDPIVGRDDEIRQMIDILSRRRQNNPILTGEAGVGK
TAVVEGLALRVAANDVPESLQGVVIRSLDLALLQAGAGVKGEFENRLKSVVSEVKNSPVPIIIFIDEAHA
MVGSGGQAGQSDAANILKPALARGELRTIAATTWAEYKKYFEKDAALARRFQVVKVEEPSEDLAVVMLRG
LLPVMEAHHQVTITDQALQAAVRLSHRYISGRQLPDKAVGLLDTACARVAMSQATAPAKIEALNKYQQQL
EAEIIQLEKEQKTGGDHQERLHNLQCELDTTATDLQAYQALWQQECVLINRAKALSTAVLESIEPIDEQA
ELIEIKLQLSANNEPMVFFEVDENLIAEVVSDWTGIPLGRMQTDEIQQVLALDKHLKKRVIGQDHALNHL
AEVVKISRANLNDENKPNGVFLLSGPSGVGKTESALALAEQVYGSEAHITTINMSEYKEEHKVSLLLGSP
PGYIGFGEGGVLTEAVRRKPYSVVLLDEIEKAHPGVQDIFYQVFDKGTIKDGEGRDIDFKNTIIILTSNV
GTELTMQLFEDPEIAPTIEGLREALQDDLLKVFKPAFLGRINVIPYVPLDSDSLTKIAKLQIERICQRFK
NNYKAECIYTDDVVNYLIGISSDASAGARVIQQNIQKKLLPILSAKILEQLSNNKLINEINIDVINDTFD
VKMK
 
Nucleotide Sequence: 2745 bp     [Download]
>gi|54307237|ref|NC_006370.1|:740336-743080 Photobacterium profundum SS9 chromosome 1, complete genome
TTGGCAAGTGCAAACGGCTTATATGCATTTACCTACCGCAACATTAAAACGGAACACCACTCAGTTAGGT
CGAAGCGCCATGCTGGGTATTCGGTCATCGCTCGCTTTTCAGTCAGCGAGTATCTCGCTAAATTAATATC
AGTTTTAGGATGGATTATGTCAACAATGACATTGACGTCTTTGGTGGACAAATTAACACCAGAGGCAAAA
AGGACACTGGAATTGAGTGCTGCGCTTGCCAATTCACGCAGTCATTCAAGCGTAGAAATTCTTCATTGGC
TTATCAGTATTGTTGATGCTCAGTCTAGCGATTACGTTGCTGTTAGTCGTTGCTTTGACATCAACGATGC
CCAATTAAAACAAGATTTAATGGTGAAATTAGAACGTCTGCCAACAGGGTGTGATGATGCGCCTGGGCTT
GCGGTACATACGGTGAATTTATTGCGCCAAGCTTGGCTAGCCACGACCATTGAATTTAATGACAACAGTA
TAGGTGCAGTGCACCTATTATATACCATGCTAGCAGATGACAGCTTATCCTCTATTGTTGGCTTCTATAG
TAAAGAGCTCGGCAAAATCTCGCCTGCTCAGCTTCTTCATGTTTGGCCAGAATTAGTGACTAAACAAAAA
AGTAACGCTGTAGATCAAGATCCACATTTATCTGCGGGGAGTCAAACACCAGCGTTGTCTCAGTTTACCA
TTGATTTAACAGAGCAAGCTCGAAACGGTGACATTGATCCTATTGTGGGGCGTGATGATGAAATTCGTCA
GATGATCGATATTTTGTCTCGTCGTCGTCAGAATAATCCTATTTTAACCGGTGAGGCGGGGGTGGGTAAA
ACGGCTGTTGTTGAAGGGTTAGCCCTTCGAGTTGCTGCCAATGACGTGCCTGAAAGTTTGCAGGGTGTTG
TTATTCGCTCGCTTGATCTTGCGTTATTGCAAGCAGGAGCAGGCGTTAAAGGTGAATTTGAGAACCGCTT
AAAGTCAGTGGTCAGTGAAGTGAAAAATTCACCCGTGCCCATTATCATTTTTATAGATGAAGCACATGCG
ATGGTGGGTAGTGGCGGGCAAGCAGGGCAAAGTGATGCCGCCAATATTTTAAAGCCAGCTTTAGCGCGTG
GTGAATTACGTACTATTGCCGCCACAACATGGGCTGAATATAAAAAATATTTTGAAAAAGATGCAGCACT
TGCTCGGCGATTTCAGGTTGTTAAAGTGGAAGAGCCGAGTGAAGACTTAGCCGTTGTAATGTTGCGAGGC
TTACTGCCTGTTATGGAAGCACACCATCAGGTCACGATTACCGATCAAGCACTACAAGCGGCGGTAAGAC
TTTCTCATCGCTACATCAGTGGGCGACAACTTCCTGATAAAGCGGTTGGTTTGTTAGACACTGCCTGTGC
TCGTGTGGCGATGAGTCAAGCGACAGCGCCTGCTAAGATTGAAGCACTGAACAAATATCAGCAGCAGTTA
GAAGCTGAAATTATTCAACTTGAAAAGGAACAAAAAACAGGGGGGGATCATCAAGAGCGGCTCCATAACT
TGCAGTGCGAACTAGATACAACCGCGACTGATTTGCAGGCCTACCAAGCACTTTGGCAACAAGAGTGTGT
ATTAATAAACAGAGCAAAAGCATTATCAACGGCAGTGCTTGAGTCCATTGAACCGATTGATGAACAAGCA
GAACTGATTGAGATTAAACTGCAGTTATCAGCGAATAATGAACCAATGGTCTTTTTTGAAGTGGATGAAA
ATCTTATCGCAGAGGTGGTTTCAGATTGGACTGGGATCCCATTGGGAAGAATGCAAACGGATGAGATCCA
GCAGGTGTTGGCACTTGATAAGCATTTGAAAAAAAGAGTGATTGGTCAAGATCATGCGCTGAATCATCTT
GCTGAAGTGGTAAAAATTTCACGTGCTAATTTGAATGATGAAAATAAGCCCAATGGGGTGTTTTTATTAT
CTGGACCAAGTGGTGTAGGTAAAACCGAATCTGCTTTGGCGTTGGCTGAGCAAGTTTATGGTAGCGAAGC
GCATATTACGACAATAAACATGTCGGAATATAAAGAAGAGCATAAAGTGTCTTTATTACTCGGCTCTCCT
CCTGGTTATATAGGCTTTGGAGAAGGTGGGGTGCTTACAGAGGCTGTACGTCGTAAACCTTACAGCGTTG
TATTGCTAGATGAAATAGAAAAAGCCCATCCTGGTGTTCAAGATATCTTTTATCAAGTGTTTGATAAAGG
AACCATTAAAGATGGGGAAGGGCGCGATATTGACTTTAAGAACACCATTATTATATTGACTTCAAATGTT
GGTACCGAGCTGACTATGCAGCTTTTTGAAGATCCTGAAATAGCACCAACGATAGAAGGATTAAGAGAGG
CATTACAGGATGATTTGCTGAAAGTCTTTAAACCTGCATTTTTAGGGCGTATTAATGTTATTCCTTATGT
GCCATTAGATTCTGATTCATTGACAAAAATTGCCAAGTTACAGATTGAGCGGATTTGTCAGCGTTTTAAG
AATAATTATAAGGCGGAATGTATTTATACTGATGATGTGGTTAATTACCTTATAGGAATATCCAGTGATG
CAAGTGCTGGTGCTAGGGTTATTCAACAAAACATACAAAAAAAATTACTTCCTATTCTATCAGCGAAGAT
ATTAGAACAATTATCAAATAACAAATTAATCAATGAGATTAACATTGACGTTATAAATGATACCTTTGAC
GTAAAAATGAAATGA