SecReT6
Protein ID: 54307878
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0675
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]743850..745700 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ6LUC9
KEGG IDppr:PBPRA0675
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-57, Aligned region: 30..338
Phage_base_V [PF04717], Evalue: 1.70E-25, Aligned region: 377..470
Gp5_C [PF06715], Evalue: 1.60E-05, Aligned region: 526..547
Gp5_C [PF06715], Evalue: 1.60E-05, Aligned region: 542..560
DUF2345 [PF10106], Evalue: 0.0032, Aligned region: 560..597
Protein Sequence: 616 a.a.     [Download]
>gi|54307878|ref|YP_128898.1| hypothetical protein PBPRA0675 [Photobacterium profundum SS9]
MKDATQDNNCIILSTPLGKDALILTGFDYHEEISGLFSLKAQAFANGVFINREGLIGSNVSVALKYNIGK
QLLTRYFNGIVVQIDCVGSRMPDKAESELYQDYILTIRPDFYLASFKCHYKIYQDKNVEEILGDVLGRHG
ISFRDDRSKTYPIYGYKVQYHESDLDFVLRLLQDEGIFFFFEHSQDSHQLIIADSVDAYAECEDGNVRHV
TGSCNDPHVHHWTTGLQLAAGQSAISGFDLQSPMNPPSAMHSHYSQGINPPESELYQYQGESGFNPRVNF
SSGNILEALQRDTFACSGSSNCRSFSAGKTFTFIDHEDPAQIGKSYVFTQLHLHVSIQSQTGALKNTHQI
IHNQFSCVPNTVAYRPHNIVTKPKVYGVQTATVSGKEGEEVYLDPLGRVKVKFHWDRDGQNNEFSSCWIR
VAQAWAGAGWGCFFTPRVGQEVLIDFINGDPEQPIICGSLYNASQLPPYSQGAINGIKTRSLDGKGSNYS
EIRFDDTKGSEKLAFHAEKDHCVVVENDHLEVVENNHQLSVKNDRTITVENNQKIVVNNNRNIDVKNDQT
CKAGQKIVIEAGQEIVLKTGSASITMSSGGDISIKGSNIKINGQAITLKAGKIALN
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|54307237|ref|NC_006370.1|:743850-745700 Photobacterium profundum SS9 chromosome 1, complete genome
ATGAAAGATGCCACACAAGATAATAATTGTATTATATTATCAACGCCCTTAGGAAAAGATGCATTAATCC
TGACTGGCTTTGATTACCATGAAGAAATATCAGGTTTGTTTTCATTAAAAGCTCAAGCTTTCGCGAATGG
CGTATTCATTAACCGTGAAGGTTTGATTGGCTCGAATGTATCTGTTGCACTTAAATATAATATTGGAAAG
CAGCTATTAACGCGTTATTTTAATGGCATTGTTGTACAGATTGACTGTGTTGGCAGCCGAATGCCAGATA
AAGCAGAGAGTGAGCTTTACCAAGATTATATTTTAACGATCAGACCCGATTTTTATTTGGCTAGCTTTAA
ATGTCATTATAAAATTTATCAAGATAAAAACGTAGAAGAAATTTTAGGTGATGTGCTTGGGCGTCATGGT
ATTTCATTTAGAGATGATAGAAGTAAAACCTATCCAATATATGGCTATAAAGTTCAGTATCATGAATCTG
ATTTGGATTTTGTACTTCGTCTTCTTCAGGATGAAGGGATATTTTTCTTCTTTGAACACAGCCAAGATAG
CCATCAGCTAATTATAGCTGACTCCGTTGATGCTTATGCGGAATGTGAAGATGGTAATGTTCGTCATGTG
ACGGGATCATGTAATGATCCTCATGTTCACCATTGGACGACAGGGCTACAGTTGGCAGCAGGACAAAGCG
CTATATCTGGTTTTGATTTACAGAGCCCAATGAATCCGCCTTCTGCGATGCATAGTCATTATTCTCAAGG
TATCAATCCGCCTGAAAGTGAGCTTTATCAATATCAAGGAGAGTCGGGTTTTAATCCCAGAGTCAATTTT
AGCTCAGGTAATATTCTAGAAGCATTACAACGCGATACTTTTGCGTGTAGTGGCTCTAGTAACTGTCGTT
CATTTTCAGCAGGTAAAACATTTACTTTTATTGATCACGAAGATCCTGCTCAAATTGGCAAAAGTTATGT
TTTTACGCAATTACATCTACATGTATCTATACAGTCTCAAACAGGGGCTCTCAAAAATACTCACCAAATT
ATTCATAACCAATTTAGCTGTGTACCCAATACCGTTGCGTATCGCCCCCACAATATTGTGACAAAACCCA
AAGTGTATGGTGTGCAAACTGCGACGGTATCAGGCAAAGAGGGGGAAGAAGTCTATCTTGATCCGCTTGG
CCGTGTGAAAGTGAAGTTTCACTGGGATCGTGATGGCCAAAATAATGAGTTTAGTTCATGTTGGATTCGA
GTTGCTCAAGCATGGGCAGGTGCAGGTTGGGGCTGTTTCTTTACTCCGAGGGTTGGTCAGGAAGTTCTCA
TCGACTTTATTAATGGCGATCCAGAACAGCCGATTATTTGTGGCTCTCTTTACAATGCTAGTCAGCTACC
GCCATATAGCCAAGGCGCTATTAATGGCATTAAAACGCGTTCTCTTGATGGCAAGGGGAGCAACTATAGT
GAAATACGATTTGATGATACTAAAGGCAGTGAAAAATTAGCTTTTCATGCAGAAAAAGATCATTGCGTTG
TTGTTGAAAATGATCACCTTGAAGTTGTTGAAAATAATCATCAATTATCGGTAAAAAATGATCGCACTAT
TACGGTTGAGAATAACCAAAAGATTGTAGTGAATAATAATCGCAATATCGATGTAAAAAATGATCAAACC
TGTAAGGCGGGTCAGAAAATAGTGATTGAAGCCGGCCAAGAAATTGTTTTAAAAACGGGCTCGGCATCAA
TCACTATGTCAAGTGGTGGTGACATTAGTATTAAAGGATCAAATATAAAGATTAATGGCCAGGCAATTAC
CCTTAAGGCTGGGAAAATTGCGCTTAACTAA