SecReT6
Protein ID: 54307879
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0676
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]745739..746029 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ6LUC8
KEGG IDppr:PBPRA0676
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.80E-24, Aligned region: 1..18
PAAR_motif [PF05488], Evalue: 1.80E-24, Aligned region: 19..89
DUF4150 [PF13665], Evalue: 6.60E-06, Aligned region: 29..50
DUF4150 [PF13665], Evalue: 6.60E-06, Aligned region: 60..82
Protein Sequence: 96 a.a.     [Download]
>gi|54307879|ref|YP_128899.1| hypothetical protein PBPRA0676 [Photobacterium profundum SS9]
MGKPAAVLSSHHVCPQYSGKIPHCGGPIVAGSGNVFIGGLPAAKQGDQMVCYGGPPDSISAGSGSVFING
KPAARMGDSSSHGGKIVAGIANVLIG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|54307237|ref|NC_006370.1|:745739-746029 Photobacterium profundum SS9 chromosome 1, complete genome
ATGGGTAAGCCAGCAGCGGTACTTAGTTCGCATCATGTATGCCCTCAATATTCAGGTAAAATACCGCATT
GCGGTGGGCCGATTGTTGCGGGCTCAGGTAACGTATTTATCGGAGGTTTACCTGCCGCGAAGCAAGGTGA
TCAAATGGTCTGTTATGGTGGCCCCCCCGATAGTATATCGGCTGGTTCGGGTAGTGTCTTTATCAATGGC
AAACCTGCAGCACGCATGGGTGATAGCTCATCACACGGTGGAAAAATAGTGGCAGGAATTGCCAATGTAT
TAATTGGTTAA