SecReT6
Protein ID: 543974528
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4397
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1437052..1438887 [-]
Producthypothetical protein
NoteTssI
UniProt IDU3AGI3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.70E-62, Aligned region: 31..335
Phage_base_V [PF04717], Evalue: 1.60E-24, Aligned region: 377..470
Protein Sequence: 611 a.a.     [Download]
>gi|543974528|ref|YP_008549274.1| hypothetical protein N646_4397 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MKRATQDNNFIRISSPFGKDAIILNSFEYKEEISELFSLRAKAYFNDQRSELNEIIGKEVTITLENNEDV
SSNPRYMHGYVSAARLEGKRVSNTHKGENYKNIELLIEPKLRFAEYRKNCRIFQHKDIKEIISEVLSEHS
VAFSFELTKSYPKYTYKVQYEESDLEFVRRLLSEEGLSFCFTHTKSAHTLNIFDDISFYKPGTEFLVDFD
TGTAKSSHISSWHETQILTTKASQKSGYNMLKPSSNPKNTAKGESDFFTVPESEYFEYMGEMESNDQYAL
RNTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKSRVGKEYVLSSVFLSAAVYNQTGQGGTGAQG
VKVSFSCVDSKTILRPSVNYPKPQMKGLQTAIVTGNKDGEIYIDKHGRIKVQFHWDRVGKYDVNSSCWIR
VAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTGSLYNGSQLPPYALPEQSSQSGYKSRSVQKGTS
NFNELRFDDKPGEEHIYLHAEKLFQMLVEDCVDIAVENSKTEKVTNDVNQEVGQNASLKVGKNFSNETGE
VLSFNAGKSVEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1438887-1437052 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAAAAGAGCAACTCAAGATAACAATTTCATCCGAATTTCTTCCCCATTCGGTAAAGATGCCATCATAC
TAAACTCGTTTGAGTATAAAGAAGAGATCTCAGAACTTTTTTCATTGCGTGCTAAAGCTTACTTTAATGA
TCAACGAAGTGAGTTAAACGAAATTATTGGTAAGGAAGTTACCATTACCCTTGAAAATAATGAGGATGTT
TCTTCAAATCCTCGTTATATGCATGGTTACGTTTCTGCTGCAAGATTAGAAGGGAAAAGGGTTTCTAATA
CACATAAAGGCGAAAATTATAAAAACATAGAATTATTAATAGAGCCTAAATTACGTTTCGCTGAATATCG
AAAAAATTGCAGAATATTTCAGCATAAAGATATAAAGGAAATTATCTCTGAAGTACTATCGGAGCATAGT
GTTGCCTTTAGTTTTGAGCTAACCAAGTCCTATCCTAAATACACGTACAAAGTACAATATGAAGAATCAG
ATCTTGAATTTGTTCGACGTCTGTTATCGGAAGAGGGGCTATCATTTTGTTTTACACATACTAAGTCTGC
CCATACGCTCAATATTTTTGATGACATCAGTTTTTATAAGCCGGGTACTGAGTTTTTAGTCGATTTTGAT
ACAGGTACGGCGAAATCTAGCCACATTTCTTCTTGGCATGAAACGCAAATTCTGACTACTAAAGCGAGTC
AAAAGTCAGGCTATAACATGCTCAAGCCTTCTTCGAATCCTAAAAATACTGCAAAGGGTGAAAGTGATTT
TTTTACAGTGCCTGAAAGCGAGTATTTTGAATACATGGGTGAAATGGAGAGCAATGATCAATACGCACTG
AGAAACACGCATGCAATAGAAGCACTACAGCAAAATGCATATTTGTGTCGTGGCGAGGCTACGTGCAGAA
CATTCAGCGTAGGCAAGTGCTTCAAGTTTAAAAAACATGAAGATAAATCTCGAGTTGGCAAAGAATATGT
ACTGTCTTCTGTTTTTTTGTCTGCTGCTGTTTATAACCAGACTGGTCAAGGTGGCACCGGTGCGCAAGGT
GTCAAAGTCTCGTTTAGTTGTGTTGACTCAAAGACAATCCTTCGTCCTTCAGTTAACTATCCGAAACCTC
AGATGAAAGGTTTGCAAACTGCAATAGTTACGGGGAACAAAGATGGTGAAATTTACATAGACAAACATGG
CCGTATCAAAGTTCAGTTTCACTGGGACCGTGTTGGTAAATACGATGTAAATAGTTCATGTTGGATTCGT
GTTGCGCAAAATATCGCAGGTAACGGATGGGGGTCGGTGTTTCACCCTAGAGTCGGACAAGAGGTCATCG
TCGAGTTTGTCAACGGAGACCCTGATCAACCAATCGTTACGGGGTCACTATATAACGGTAGTCAACTCCC
TCCTTACGCTTTACCAGAGCAAAGTTCTCAGAGTGGTTATAAATCACGCTCTGTACAAAAAGGTACATCC
AATTTTAATGAGTTGCGCTTCGATGATAAGCCTGGTGAAGAGCACATTTATCTTCATGCTGAAAAACTGT
TCCAAATGCTAGTTGAAGACTGTGTTGATATCGCCGTTGAAAACAGTAAAACCGAAAAAGTGACCAATGA
TGTTAATCAAGAGGTTGGTCAGAACGCGAGCTTGAAAGTAGGTAAAAACTTTTCGAATGAAACGGGTGAA
GTACTGTCTTTTAATGCAGGAAAGAGCGTCGAGATCAAAGTAGGTGGTGCTTCTATTCAGATGTCTAGCT
CTGGAGAAATCAATATCAAAGGTAATAAAATATCCATTAACGGCTCAGCTATTGCTCTTAAAGCTGGGCA
AATTTCATTGAACTAA