SecReT6
Protein ID: 543974529
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4398
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1438937..1439416 [-]
Producthypothetical protein
NoteTssD
UniProt IDU3C1M0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|543974529|ref|YP_008549275.1| hypothetical protein N646_4398 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1439416-1438937 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAGGGTGAGGCAACAGCCGAGCAATACAAAGATT
TGATTACACTACTATCTGTAGATTGGAGTGTAGGTCGTGAGATCTCATCATACACTGGTACAGCGATGGA
CCGTGAAGCGAGCGCTACTCGTCTATATGATTTGACTATCACTAAACTTCAAGACCGTTCTTCTCCTGAC
TTATTTAAAGAAGCGACGATTGGTAAAGGTAAACCAGCGGTTTTCCATATTACTAAGCAGGGTGAGAAGG
TTGAAGAGATCATGAAGATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTTTCTATCCAAGACGA
TCGTCCAGTTGAAACTATCACAATTTCTTACACAGAAATGATGATGACAGTGACTCCTACTGACGATAAG
AACAACACTTCTGCTCCATTGGTATACGGCTACAGCGGTGTTAAAGGTCAACAAATGTAA