SecReT6
Protein ID: 543974530
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4399
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1439625..1442192 [-]
Productputative ClpA/B-type chaperone
NoteTssH
UniProt IDU3BSM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-39, Aligned region: 213..233
AAA_2 [PF07724], Evalue: 2.90E-39, Aligned region: 587..753
AAA [PF00004], Evalue: 5.70E-20, Aligned region: 213..344
AAA [PF00004], Evalue: 5.70E-20, Aligned region: 593..711
AAA [PF00004], Evalue: 5.70E-20, Aligned region: 772..826
AAA_5 [PF07728], Evalue: 6.20E-13, Aligned region: 213..289
AAA_5 [PF07728], Evalue: 6.20E-13, Aligned region: 592..713
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 190..233
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 256..291
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 448..518
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 561..624
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 657..686
AAA_16 [PF13191], Evalue: 4.60E-12, Aligned region: 750..793
ClpB_D2-small [PF10431], Evalue: 2.70E-11, Aligned region: 760..834
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 212..294
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 330..385
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 590..627
Sigma54_activat [PF00158], Evalue: 1.50E-08, Aligned region: 209..253
Sigma54_activat [PF00158], Evalue: 1.50E-08, Aligned region: 573..710
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 213..324
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 590..680
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 213..234
AAA_19 [PF13245], Evalue: 1.30E-06, Aligned region: 586..615
IstB_IS21 [PF01695], Evalue: 5.50E-06, Aligned region: 207..236
IstB_IS21 [PF01695], Evalue: 5.50E-06, Aligned region: 591..625
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 213..286
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 588..614
AAA_25 [PF13481], Evalue: 5.10E-05, Aligned region: 655..676
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 213..281
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 591..627
NTPase_1 [PF03266], Evalue: 0.00012, Aligned region: 213..233
NTPase_1 [PF03266], Evalue: 0.00012, Aligned region: 592..630
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 586..603
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 584..633
Clp_N [PF02861], Evalue: 0.00026, Aligned region: 24..75
Clp_N [PF02861], Evalue: 0.00026, Aligned region: 106..125
T2SE [PF00437], Evalue: 0.00043, Aligned region: 204..233
T2SE [PF00437], Evalue: 0.00043, Aligned region: 580..624
T2SE [PF00437], Evalue: 0.00043, Aligned region: 828..847
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 213..278
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 462..518
AAA_18 [PF13238], Evalue: 0.0005, Aligned region: 593..631
NACHT [PF05729], Evalue: 0.00053, Aligned region: 213..240
NACHT [PF05729], Evalue: 0.00053, Aligned region: 592..613
Arch_ATPase [PF01637], Evalue: 0.00057, Aligned region: 192..233
Arch_ATPase [PF01637], Evalue: 0.00057, Aligned region: 586..624
UPF0079 [PF02367], Evalue: 0.00075, Aligned region: 213..233
UPF0079 [PF02367], Evalue: 0.00075, Aligned region: 579..621
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 211..232
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 280..293
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 551..613
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 660..686
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 821..848
AAA_30 [PF13604], Evalue: 0.0028, Aligned region: 210..234
AAA_30 [PF13604], Evalue: 0.0028, Aligned region: 587..621
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 213..234
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 282..291
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 560..628
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 593..616
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 693..711
DUF815 [PF05673], Evalue: 0.0059, Aligned region: 208..288
DUF815 [PF05673], Evalue: 0.0059, Aligned region: 572..617
DUF258 [PF03193], Evalue: 0.0064, Aligned region: 209..232
DUF258 [PF03193], Evalue: 0.0064, Aligned region: 577..603
Protein Sequence: 855 a.a.     [Download]
>gi|543974530|ref|YP_008549276.1| putative ClpA/B-type chaperone [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MASLSLSALVERLSPQAKETLEQAAAMASSRTHHSIEMSHWLMMIIRHPDDIYSEVFDEFDVDKIKVETD
IQKALEKYKTGCQSVPGLSAHTVTVMQNALLSATIEFNQEQLGCIHLLFAYLSDDTLVNMAGSISPELNK
IEPSRLLNFKESNAPQSRSNDLAQSNANSALNQFTTDLTEQAREGKIDPVIGRDNEIRLMIDILLRRRQN
NPILTGEAGVGKTAVVEGLAQKIIDGDVPPALQNVAIKSLDLALLQAGAGMKGEFENRLKNLVKEVNDAP
QPIILFIDEAHGLIGGGGQAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKDAALTRRFQVVKVDE
PAPELAIEMLRGLLDVMAQHHDVHITNQALNAAVQLSARYINGRQLPDKAVSVLDTACSRVALSQSSTPG
GLDAKRNKLKAKQAEYEHLSQESRLGASLDVQLQGVRKEIDALSNDIIELEVLWEKEKEWVNEAKSLRTQ
IIQEGSETARDKLQELENNLSANSQPLVFSHVNEALIAEVISDWTGIPLGKLQDDEIQAVLGLKESLCKR
VVGQDHALELMSEVIKTASAQLTDETRPNGVFLLTGPSGVGKTESALAIAEKVYGSEENVTTINMSEFKE
EHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGSIKDGEGRDIDF
KNTIIIMTANTGTETTMSLYSDPDLSPEPSALKDALRDDLLVDFKPAFLGRVNVLPYLPLSRKVLIEITK
LKLDKITTRIRKHYNADLFFDEELINDIVDNSNESGSGARVVQTTIENTLLPKISHEILHAILNDKTFDE
IIVKGTTSGLDVSIV
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1442192-1439625 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGCTTCACTCTCACTTTCAGCGTTGGTCGAAAGATTGTCTCCTCAGGCTAAGGAAACACTTGAACAGG
CAGCTGCGATGGCAAGCTCCCGAACTCATCACAGTATTGAAATGTCTCACTGGTTAATGATGATTATCCG
CCATCCTGACGATATTTACTCTGAAGTTTTTGACGAATTTGATGTCGATAAAATCAAGGTTGAAACCGAT
ATTCAAAAGGCATTAGAAAAATACAAAACAGGATGCCAGTCGGTGCCTGGGCTATCAGCTCATACGGTGA
CTGTTATGCAAAATGCCTTGTTGTCTGCAACCATTGAATTCAATCAAGAACAGTTGGGGTGCATCCATCT
TTTATTTGCCTACTTGTCTGATGATACGTTAGTCAACATGGCTGGTTCGATTAGTCCTGAACTAAACAAG
ATAGAACCATCTCGCTTATTGAACTTTAAAGAAAGTAATGCGCCTCAATCAAGATCGAATGACTTAGCGC
AGTCAAACGCGAATTCCGCCTTGAATCAATTTACAACAGACCTTACTGAGCAAGCTAGGGAAGGTAAAAT
AGATCCGGTGATTGGTAGAGATAATGAAATTCGCCTAATGATCGATATTTTATTAAGACGCCGACAAAAC
AACCCGATTCTTACGGGAGAAGCTGGTGTTGGAAAAACAGCCGTTGTTGAAGGTTTGGCGCAAAAGATCA
TTGATGGCGATGTACCTCCCGCTCTGCAAAATGTGGCAATTAAGTCTCTGGATTTGGCGTTACTGCAAGC
CGGCGCAGGCATGAAAGGTGAGTTTGAAAACAGGCTTAAGAACCTTGTTAAGGAAGTAAACGACGCTCCA
CAGCCTATTATATTGTTCATTGATGAAGCTCATGGCCTAATTGGCGGTGGTGGGCAAGCGGGCCAAGGTG
ATGCGGCGAATATTCTGAAGCCAGCATTAGCGAGAGGTGAACTCAGAACGATCGCAGCAACAACGTGGGC
AGAGTATAAAAAGTATTTTGAAAAAGATGCAGCTTTAACTAGGCGTTTTCAAGTCGTAAAGGTTGATGAG
CCTGCCCCTGAACTCGCGATCGAAATGTTACGAGGCTTACTTGATGTAATGGCACAACACCACGATGTTC
ATATCACTAACCAAGCTCTCAATGCAGCGGTCCAACTGTCAGCTCGATACATTAATGGTCGTCAACTGCC
AGATAAAGCGGTTTCTGTTTTGGATACGGCCTGTTCTCGAGTTGCGTTAAGTCAGTCATCTACACCGGGA
GGCCTAGATGCGAAAAGAAACAAACTTAAAGCAAAGCAAGCTGAGTATGAGCATCTTAGCCAAGAGAGTC
GGCTAGGAGCATCTCTTGATGTGCAGCTGCAAGGTGTCCGAAAAGAGATTGATGCGCTATCTAATGACAT
TATTGAATTAGAAGTACTTTGGGAAAAAGAAAAAGAATGGGTAAATGAAGCTAAGTCACTTAGAACCCAA
ATAATCCAGGAGGGTTCTGAAACTGCTAGAGACAAGTTACAAGAGCTTGAAAATAACCTTTCCGCTAACT
CACAGCCCTTAGTTTTTTCGCATGTAAATGAAGCGCTAATCGCAGAAGTTATTTCGGATTGGACCGGTAT
ACCGCTAGGTAAACTTCAGGATGATGAAATCCAAGCAGTATTGGGTTTGAAAGAAAGTTTGTGTAAGCGA
GTTGTCGGGCAGGATCACGCTTTAGAGCTCATGTCTGAAGTGATAAAAACCGCGAGTGCGCAGCTCACGG
ATGAGACACGACCAAATGGTGTATTTCTCCTAACCGGACCAAGCGGAGTGGGTAAAACCGAATCGGCTTT
GGCGATTGCAGAGAAAGTCTATGGTAGTGAAGAAAATGTCACGACTATCAATATGTCGGAATTTAAGGAA
GAGCATAAAGTCTCATTGCTATTAGGTTCTCCTCCTGGTTATGTCGGTTATGGAGAAGGAGGTGTACTGA
CTGAAGCTGTTAGACGTAAACCTTATAGTGTAATTCTCCTCGATGAAATGGAAAAAGCGCACCCTGGTGT
TCAAGATATTTTTTATCAGGTGTTTGATAAAGGCTCAATTAAAGACGGTGAAGGTCGAGATATAGACTTT
AAAAACACTATTATTATTATGACCGCGAACACAGGGACCGAAACGACGATGTCTTTGTATTCTGATCCTG
ATTTATCTCCTGAGCCGTCAGCACTAAAAGATGCTTTACGCGATGATTTGTTGGTCGACTTTAAACCTGC
ATTTTTAGGGCGTGTGAACGTATTACCTTATTTGCCTCTATCAAGAAAAGTATTGATAGAAATAACAAAA
TTAAAGTTGGATAAAATTACGACTCGTATTCGTAAGCACTATAACGCTGACCTGTTTTTTGATGAGGAAC
TAATTAATGATATTGTAGACAATAGCAATGAGTCTGGCAGTGGTGCGCGTGTGGTACAAACAACCATAGA
AAATACATTGCTTCCGAAGATTTCTCATGAAATATTGCATGCAATTCTTAATGATAAGACGTTTGATGAA
ATTATTGTTAAAGGTACAACTAGTGGACTTGATGTCTCAATAGTTTAA