SecReT6
Protein ID: 543974531
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4400
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1442203..1443168 [-]
Producthypothetical protein
NoteTssG
UniProt IDU3AFE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.10E-74, Aligned region: 8..307
Protein Sequence: 321 a.a.     [Download]
>gi|543974531|ref|YP_008549277.1| hypothetical protein N646_4400 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSAEQFYRELKQHPLFEAIHLIEHEVLQAEAQIGTDALPKHEKLNLKVNPSLGFENAQLCELKNIDDSKL
EIETNLIGLTGEQGVLPQHYSELALHRQKEGDTAMVDFYDIFNHRLLSLYYRCWQLSQLTVQSRAHAQGA
RSPLESCKSALTGKGSSLSRHYGGVFASPVRSKGGLKSILECLSGCQVKVHEFQGQWLHLTKEEQTRLAS
RTMPEGQFAQLGLGASLGSKAWNINAGTTIEFLPKDKQLVSKLLPNQPNIAIIKNAAYELIGKHKQLKWQ
LTTKHSLLPQACLSKQQGQLGIGSVLKKHERTKDRTITITI
 
Nucleotide Sequence: 966 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1443168-1442203 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAGCGCGGAACAATTTTATCGAGAATTAAAGCAACATCCATTGTTTGAAGCGATTCATCTTATTGAAC
ACGAAGTTCTGCAAGCAGAGGCGCAAATAGGAACAGATGCGTTACCGAAGCATGAAAAGCTAAACTTAAA
GGTTAATCCATCATTAGGTTTTGAAAATGCTCAGCTTTGTGAACTGAAAAATATAGATGACAGCAAGTTA
GAGATTGAGACCAATTTAATAGGCCTAACGGGTGAGCAAGGTGTGCTTCCCCAGCACTATAGTGAATTAG
CTTTACATCGCCAAAAAGAAGGCGATACGGCTATGGTGGACTTCTACGATATTTTCAATCATCGCTTATT
ATCTCTTTATTATCGATGTTGGCAACTGAGTCAGCTGACTGTTCAGTCTCGTGCGCATGCGCAGGGCGCG
CGTTCGCCGTTAGAAAGCTGTAAATCGGCATTAACTGGGAAAGGGAGTTCACTGTCCCGGCACTATGGTG
GTGTGTTTGCTTCACCAGTGAGAAGTAAAGGTGGACTGAAAAGTATTCTTGAATGTTTATCTGGATGCCA
AGTAAAAGTTCATGAATTTCAAGGACAATGGTTACACCTTACGAAAGAAGAGCAAACACGCCTTGCATCC
CGAACTATGCCTGAAGGGCAGTTTGCTCAACTTGGTTTAGGAGCGTCTTTGGGTTCGAAAGCATGGAACA
TCAACGCGGGGACAACAATAGAATTTCTGCCAAAAGATAAACAGCTAGTTAGTAAATTGCTTCCTAACCA
ACCCAATATAGCAATCATTAAGAACGCTGCTTATGAGTTGATTGGAAAACATAAACAACTGAAGTGGCAG
CTCACCACCAAACATAGTTTGCTACCACAAGCTTGTTTATCGAAACAGCAGGGGCAGTTAGGTATTGGTT
CTGTGCTTAAAAAACACGAACGTACAAAAGATCGAACTATAACAATTACTATTTAA