SecReT6
Protein ID: 543974532
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4401
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1443165..1444988 [-]
ProductVAT2t
NoteTssF
UniProt IDU2ZXH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-190, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|543974532|ref|YP_008549278.1| VAT2t [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVDDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKMSCSNSTSSYFDVEEGERVVIGATGYHECEFRTCYPVRMYPVDVTS
GVFKNAPFKPVGSRWESNAHSVLKVQLTAQDEETPLGEMGIERLRFYLNGQSQLTFKLYQMLFQNLIGLS
VVVDGKEVRPLTKRHLSEVGFSEDEKVVPYSKRSFSGARLLVEYLHFPEKFMFFDITELGLSELDLGEQV
ELYFYFDTNDDWLPKQVDEESLMVGCVPVINLFKSIMEPKRILPTEYDYHLSPQYQESESNEVVSISDVT
LRNWNKTYHNLPCYHAGEHTHYTNTSEIYWLMRREDKNWAGGYDEPGRETYISFVDKKHQLFSPDSRENW
LMYVEAECCNRNLAQKLPFGGGLPQVSLPEVNDNFESVRCLVSLSETIRPEMDESTRWQLTKLLTLNHFT
EEDGLATLKQTLNLYAFSGTAETKAVIDALTKLEFEPTTGRISQKGKVGFAHGIKIILTVSDQILPKEQI
FLLGSVLSVYFSQYAEINIFTQLEIRIKSTGKSFHLWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1444988-1443165 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAGTGAAGAGTTTCTCAAGTACTATAATCGCGAGTTAGCTTATTTGCGTCACAAAGGGCAAGAGTTTG
GTGAGCAGTATCCCAAGATTGCCGCGAGACTTCGTATTAGTGAGGAACAGGTTGACGATCCACACGTAGA
AAGATTGTTAGAAGGCTGCGCATTTCTAACAGCAAGGATTAGACAAAGCTTAGACAATAGTTACCCTCAG
TTTACAGAGTCTTTGATGGGACAGTTATATCCGGATTTTCACGCCCCAATCCCGTCAATGTCAGTCATTA
AAATGAGCTGTTCTAACTCCACTTCCTCTTATTTTGATGTAGAAGAAGGCGAGCGAGTTGTTATCGGTGC
TACTGGATATCATGAATGCGAGTTTAGAACTTGTTATCCGGTCAGAATGTATCCTGTTGATGTGACCTCT
GGCGTTTTTAAAAATGCGCCTTTCAAGCCAGTTGGCTCACGATGGGAAAGCAATGCTCATTCAGTTTTGA
AAGTACAGCTCACGGCTCAAGATGAAGAGACTCCTCTTGGTGAAATGGGGATAGAACGGCTGCGCTTCTA
TTTAAACGGTCAATCTCAATTGACTTTTAAGCTCTACCAAATGCTGTTTCAAAACCTAATTGGTTTATCT
GTTGTTGTGGATGGCAAAGAAGTTCGTCCTTTAACCAAAAGACATCTTTCTGAAGTAGGATTTTCAGAAG
ATGAGAAAGTTGTGCCATACAGTAAAAGAAGCTTTTCAGGAGCAAGATTACTTGTTGAGTATTTGCACTT
TCCTGAGAAGTTTATGTTCTTTGATATCACCGAACTTGGATTATCTGAGCTAGATCTTGGAGAGCAAGTC
GAACTGTATTTTTACTTTGATACCAACGATGACTGGCTTCCAAAGCAAGTGGACGAAGAAAGCTTAATGG
TAGGTTGTGTGCCTGTAATCAACTTATTTAAAAGTATTATGGAGCCTAAGCGTATTCTACCAACTGAATA
CGATTACCACTTGTCTCCGCAATACCAAGAATCTGAAAGTAATGAGGTTGTCTCAATTTCTGACGTAACG
TTGAGAAACTGGAACAAAACGTACCACAATTTGCCATGTTATCACGCTGGTGAGCACACGCATTATACAA
ACACTAGTGAGATTTATTGGTTGATGAGACGTGAGGATAAGAACTGGGCTGGTGGGTATGATGAGCCAGG
TAGAGAAACTTACATTTCTTTTGTTGATAAAAAACATCAATTGTTCAGCCCGGATAGCCGGGAAAACTGG
TTAATGTACGTGGAAGCTGAGTGCTGTAACCGCAACTTAGCGCAGAAACTTCCATTTGGAGGTGGGCTGC
CGCAAGTATCTTTACCGGAGGTAAATGACAATTTCGAATCTGTTCGTTGTTTAGTTTCTTTATCAGAAAC
TATTCGGCCAGAAATGGATGAAAGCACACGATGGCAGTTAACTAAGCTTTTAACTTTAAACCATTTTACC
GAGGAAGATGGTTTAGCAACTTTGAAGCAGACCCTTAATCTCTATGCATTTTCTGGGACAGCAGAAACGA
AAGCGGTAATCGATGCTTTAACTAAGTTAGAGTTTGAGCCTACTACAGGAAGAATTAGTCAGAAAGGCAA
AGTTGGATTTGCGCACGGTATAAAAATTATTTTGACGGTTTCTGATCAAATTTTACCTAAAGAGCAGATC
TTTCTCTTAGGTAGTGTTTTATCTGTTTACTTCTCGCAATATGCTGAAATTAACATTTTTACGCAGTTAG
AAATAAGAATTAAGTCCACGGGAAAGTCTTTCCACCTATGGCCCGCATTAACTGGCGATAAGGTGTTGCT
ATGA