SecReT6
Protein ID: 543974533
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4402
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1444985..1445449 [-]
Producthypothetical protein
NoteTssE
UniProt IDU3AGI7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-20, Aligned region: 28..129
Protein Sequence: 154 a.a.     [Download]
>gi|543974533|ref|YP_008549279.1| hypothetical protein N646_4402 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSLTVSLLDKLIDSDPLTRDEKDFPASQQQMLSSLLRDLESMLNSRIGWKNIPDDLLEVRYSILNYGLPD
FSSMPYSSQEGQNQLCDIVHEAIKEFEPRLRNPHVQISDEKNAIDRVLRLQINATCLIDNSIHEVRFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1445449-1444985 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTCGTTAACCGTTTCTCTGCTCGACAAATTGATAGATAGTGATCCTCTCACTCGAGATGAGAAAGACT
TCCCTGCAAGCCAGCAACAGATGTTGAGCAGCTTACTTAGAGATCTAGAGTCGATGCTGAATAGTCGTAT
TGGATGGAAAAATATTCCTGATGATCTTCTAGAGGTTCGTTATTCAATATTGAACTATGGGCTGCCAGAT
TTTTCCTCAATGCCCTATAGCAGCCAAGAAGGGCAGAATCAGCTTTGCGACATCGTTCATGAAGCAATTA
AAGAGTTTGAGCCGAGGTTAAGGAACCCTCATGTCCAGATTTCGGACGAGAAAAACGCTATTGATAGGGT
ATTGAGGTTACAGATAAATGCCACTTGCTTAATTGATAACAGTATTCATGAAGTGCGATTCAATTCTGAA
GTAGAGCCGGTAAATTTAGGTATGAAACTGAGTAGAGCAAAATGA