SecReT6
Protein ID: 543974534
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4403
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1445457..1446251 [-]
Producthypothetical protein
NoteTagJ
UniProt IDU3C1M5
KEGG IDvag:N646_4403
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-40, Aligned region: 137..257
Protein Sequence: 264 a.a.     [Download]
>gi|543974534|ref|YP_008549280.1| hypothetical protein N646_4403 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MTQWKNALSQGLLQHALEQLIDEIKATPKDASLRSSFIELLCIDGDFERADAQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFINGAASAKVLGDEELTKELVRFNLALGNQEYEEASRLSHRIEERRTIKGFNVNGTN
YEDARDIDDRLGGYIELFSTAGNYFLVPISSIHTLEVKAPTSLLESIWRPVEFDIDGLGEGEGHMPLTYV
DSETDAQKLGRETDWKQIGEQESFVGLGQKCWLVGDSALPICDLTTLLEQKQIA
 
Nucleotide Sequence: 795 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1446251-1445457 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGACTCAATGGAAAAATGCTTTGTCCCAAGGCCTATTGCAACACGCTCTAGAGCAATTAATTGATGAAA
TTAAAGCAACCCCTAAAGATGCGAGCTTGAGAAGTTCCTTCATTGAGCTTCTTTGCATTGATGGGGACTT
CGAGCGTGCGGACGCTCAGCTCATGCAATCGATTAAATTGTTTCCTGAGTATCTGCCTGGTGCAAGTCAG
CTACGACATTTAGTGAAAGCAGCTCAAGCTAGAAAGGATTTTATCAATGGTGCGGCTAGTGCCAAAGTAT
TAGGTGATGAGGAATTAACTAAAGAGCTTGTTCGATTTAATCTTGCTCTCGGAAATCAAGAGTACGAAGA
AGCGTCACGTCTATCGCATCGCATTGAAGAGCGTCGTACTATTAAAGGGTTTAACGTAAACGGCACAAAC
TACGAAGATGCTAGAGATATTGATGATCGTTTAGGTGGTTACATTGAACTGTTTTCTACAGCAGGTAACT
ATTTTCTTGTACCCATATCGAGCATCCATACGCTAGAAGTTAAAGCACCTACTTCTTTGTTAGAAAGTAT
TTGGCGACCTGTCGAGTTTGATATCGATGGACTTGGTGAAGGCGAAGGCCATATGCCTTTGACGTATGTC
GACTCAGAGACCGATGCACAAAAGTTAGGCCGAGAAACGGATTGGAAGCAGATTGGTGAGCAAGAATCTT
TTGTTGGCTTGGGTCAAAAATGTTGGTTAGTCGGTGACTCAGCGCTTCCAATCTGTGATTTGACTACATT
ATTAGAACAGAAACAAATAGCGTAG