SecReT6
Protein ID: 543974535
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4404
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1446262..1447761 [-]
Producthypothetical protein
NoteTssC
UniProt IDT2C2P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.00E-168, Aligned region: 61..493
Protein Sequence: 499 a.a.     [Download]
>gi|543974535|ref|YP_008549281.1| hypothetical protein N646_4404 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSLNFRDPSKLKHEFSTGGYAELDSPWLTRFNESSDLVASARIWLEGTRSRDLDSFRHSVMNTINRIDEL
LESQLNEILHHPEFQQLERGWVGVRYLCEQVDSRSSDSVKVKVLTATWNEISKDALKAIEFDQSALFKLL
YQNEYGMAGGEPFGVVVGDYQLRCDPSKNYFDRDLSVLSKISQSAAAAFSPFIMSASPEMFGVDSFAQLS
AIRDIAAQFEQEDYAKWRSLRDNDDAKFIGLTAPNVLFRQPYKSDGSRNDKFNFQEHIYDSNRDLLWGSS
AYCFAAVSIRAFQEHGWFTHMRGIKQGDYSQGIIAAPTRSTMRVNGKNDRERCPLNLKITERKEQELSEC
GFISISPIPETDMVGMTSNVSLYKPKQYAEKHISTNAKLTSMLQYTLCVSRVAHYLKVMGRDKIGGYQDA
ESLERDFQRWLHQYTTASDEASDELRAKYPLNEAKITVREKRETPGHYYSVIHLRPHFQLDQMVSSIKLI
TELSPEHMV
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1447761-1446262 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
GTGTCACTTAACTTTCGCGACCCTAGCAAGCTAAAACATGAGTTCAGTACCGGAGGCTACGCTGAACTTG
ATAGCCCGTGGTTGACTCGATTCAATGAATCTTCTGATCTTGTAGCGTCAGCGCGAATTTGGCTAGAAGG
TACACGTTCAAGAGATTTGGACAGCTTTCGTCATAGTGTGATGAACACAATTAACCGCATTGATGAGCTA
TTAGAATCTCAACTAAATGAAATATTACATCATCCTGAGTTTCAACAGCTCGAAAGGGGGTGGGTTGGAG
TTAGGTATTTATGTGAACAGGTTGATTCTCGTTCATCGGACTCTGTAAAAGTTAAGGTTTTAACGGCGAC
ATGGAATGAAATCAGTAAAGATGCTTTAAAAGCCATCGAGTTTGACCAATCAGCACTATTTAAGTTGCTC
TATCAAAATGAATATGGCATGGCAGGGGGAGAACCCTTTGGTGTGGTGGTTGGAGATTATCAGCTTCGCT
GTGATCCTAGTAAAAATTATTTTGATAGAGATCTGTCTGTGTTGAGTAAGATCTCTCAGTCTGCAGCTGC
AGCATTCAGCCCATTTATCATGTCTGCATCGCCAGAGATGTTTGGTGTTGATAGTTTCGCTCAACTCTCT
GCGATAAGAGATATAGCAGCCCAATTTGAACAGGAAGATTATGCAAAGTGGCGTAGTTTGAGAGATAACG
ATGACGCTAAATTTATTGGTTTGACTGCACCTAACGTCTTGTTCCGTCAGCCATACAAAAGTGATGGCTC
GCGGAATGATAAATTCAATTTTCAAGAACACATCTACGACTCCAACCGAGATTTGCTATGGGGGAGTAGT
GCGTACTGTTTTGCTGCTGTATCAATTAGAGCATTTCAGGAACATGGTTGGTTCACGCATATGCGAGGGA
TTAAACAAGGCGATTACAGTCAGGGTATTATCGCCGCTCCTACAAGGAGCACGATGCGTGTTAATGGCAA
GAATGATCGTGAAAGATGTCCGTTAAACTTGAAAATCACTGAGAGAAAAGAGCAAGAATTGTCTGAGTGC
GGTTTTATTTCTATTTCTCCAATACCTGAGACTGATATGGTAGGGATGACCTCGAATGTATCTCTCTACA
AGCCCAAACAATACGCAGAAAAGCATATTTCAACGAATGCAAAACTGACATCGATGTTGCAATACACATT
GTGTGTATCGCGAGTCGCACATTATCTCAAGGTTATGGGGCGTGACAAAATTGGTGGGTATCAAGACGCA
GAAAGCCTAGAGCGTGACTTTCAACGCTGGTTACATCAGTACACTACCGCATCAGATGAAGCGTCTGATG
AGCTTCGAGCTAAATACCCCCTAAATGAAGCGAAAATTACAGTTCGAGAGAAAAGAGAAACTCCTGGACA
TTATTACTCAGTTATCCATTTGCGACCGCATTTTCAACTCGATCAAATGGTATCTAGCATTAAATTAATT
ACCGAATTATCACCAGAGCACATGGTGTAA