SecReT6
Protein ID: 543974536
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4405
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1447826..1449319 [-]
Producthypothetical protein
NoteTssC
UniProt IDU3AFE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-185, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|543974536|ref|YP_008549282.1| hypothetical protein N646_4405 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MTTEAEKQLDPTVNEQTTSFLDQAIGATKQTEASRAEELIKTLAEEAMKGTVTWNKNLTVTFREAINLLD
RQISDQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKVRMMSMTKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATAPVEEFGFEEFEVDPVSGIAVNAEHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGAPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1449319-1447826 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGACGACTGAAGCTGAAAAACAGTTAGATCCAACAGTTAATGAACAGACAACTTCATTCTTAGATCAAG
CTATTGGTGCGACTAAGCAGACCGAAGCTTCTCGTGCTGAGGAGCTGATTAAAACGCTCGCTGAAGAAGC
AATGAAAGGGACAGTTACTTGGAACAAAAACCTAACAGTAACTTTTCGTGAAGCGATTAATTTGCTCGAT
AGGCAGATTTCTGATCAGTTGTCTGAAGTAATGCATCACCCAGAATTACAGAAACTCGAAGGTTCTTGGC
GCGGCTTAAATTATCTAGTGATGAATTCAGAGACCAGCTCTACTCTGAAAGTTCGCATGATGAGCATGAC
CAAGAAAGAGCTACATAAAGACTTGAGCAAAGCTGTTGAGTTTGATCAAAGCCAGATCTTTAAAAAGGTT
TACGAGTCTGAGTTTGGTAGTGCTGGTGGTGAACCGTATGGTGCATTGATTGGAGACTATGAGTTTACCA
ACCACCCAGAAGATATTGAGTCGTTACGCCTAATGTCAAATGTAGCGGCTTCTGGCTTCTCTCCATTCTT
GTCCGCGGCTTCACCAGCACTATTCGGCTTTGATGAGTGGACTGAGCTGTCAAAACCACGCGACCTAGAT
AAGGTATTTGAATCACTAGAATACGCCCAATGGCGTTCGTTCCGCGAGAGTGCCGATTCGCGCTTCGTTA
GTCTGACGATGCCAAAAGTCCTTGCTCGTTTGCCATACGGACAAGCTACCGCTCCAGTCGAAGAGTTTGG
GTTTGAAGAGTTCGAAGTAGATCCTGTTTCAGGTATTGCTGTTAACGCTGAACATAACGACTACTGTTGG
ATGAACTCTTCGTATGTTCTTGGTGTTAAGTTAACCGACGCATTTTCAAAATATGGATTTTGTACTGCCA
TCCGTGGTGCAGAAGGCGGTGGTCGAGTGGATAACTTGCCAACGCATTTCTTCATGAGTGATGATGGCGA
CCCTGATATGAAGTGCCCAACAGAGATTGGTATTACCGACAGACGTGAGGCGGAGCTTGGTAAGCTTGGT
TTCTTACCGCTTTGTCACTACAAAAACACCAACTATGCAGTGTTCTTTGGTGCGCAAACCTGTCAAAAAC
CAGCGAACCATGAATCCCCTGAAGCAACGGCCAATGCGGCCATTTCTGCCCGCCTACCTTATATGATGGC
AACATCTCGTTTTGCGCATTATTTGAAAGTAATGGCTCGAGATAAAATTGGTAGCTTTATGGAAGCAGAA
GACGTTGAGTCTTGGCTGAACCGCTGGATCCTAGGTTACGTCAATGCTTCTGAAGGCGGTGGTCAAGAGA
TCAGAGCGAAATACCCTCTAGCAGACGCTCGTGTTCAGGTTAAGGAAATTCCTGGCGCACCTGGTTCTTA
CAATGCCGTAGCATGGCTGAAACCTTGGTTGCAAATGGAAGAACTGACGACATCTTTGCGACTTGTGGCC
AAGATCCCTCAGTCAGGTGGATAA