SecReT6
Protein ID: 543974537
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4406
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1449319..1449732 [-]
Producthypothetical protein
NoteTssB
UniProt IDT2C4C3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-44, Aligned region: 1..123
Protein Sequence: 137 a.a.     [Download]
>gi|543974537|ref|YP_008549283.1| hypothetical protein N646_4406 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MGDFAGQNTEALKPLKDRRFIQIDRDNFDDVLKKMNPSVKFKVANKLANDDSQFEVDLNFKSMQDFEPAA
IVNQVDPLRQLMETRNKLRDLMTKVDRSEELENILEDVLNNTDNLARLAGELDLDKKAKSDSTEGAE
 
Nucleotide Sequence: 414 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1449732-1449319 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGGTGATTTCGCTGGTCAAAACACAGAAGCGTTGAAGCCATTAAAAGACCGCCGTTTTATTCAGATCG
ATCGAGATAACTTTGACGATGTACTCAAAAAAATGAATCCATCGGTGAAGTTTAAAGTTGCGAATAAGCT
TGCGAATGACGATTCACAGTTTGAGGTCGATTTAAACTTTAAATCAATGCAAGACTTTGAGCCTGCTGCG
ATCGTAAATCAAGTTGATCCACTACGCCAATTGATGGAAACGCGTAATAAACTGCGTGATTTGATGACAA
AAGTTGACCGCTCAGAAGAGCTTGAAAATATCCTAGAGGATGTTTTGAACAATACGGACAATCTGGCAAG
ACTTGCAGGCGAGTTAGATCTTGACAAGAAAGCGAAGTCAGACAGTACTGAAGGAGCGGAATAA