SecReT6
Protein ID: 543974538
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4407
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1449865..1450980 [-]
Producthypothetical protein
NoteTssA
UniProt IDU3AGJ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-21, Aligned region: 67..127
Protein Sequence: 371 a.a.     [Download]
>gi|543974538|ref|YP_008549284.1| hypothetical protein N646_4407 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSNEMFDWYEQALAPISQENPTGVDPREDVSPQSAYYRLKDQRMAARNAERNALIEEESIYTHSNLWRVF
IEDVPEILTNQSKDLEFVAWLIEALTRLYGFRGMGVGYKLATSLIENFWDDLYPMPDEDGIETRISAIIG
LNGIDSEGTLIFPIACIPLTDLGVEQAYAYWEYQQAIELERLDEDKRRNRVELGAVELSEIITTVKSTSD
TFYRELITDLEFATESFNEFSQRLDEAVGDVTPSSYISKRLESIHSALRHLLGDRFNQPQAVIEELEDLD
ESSSEQPLSSQSCDALLATNMKSREQAIRQLQQVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAELI
SDGDAKKSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1450980-1449865 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAGTAATGAAATGTTTGATTGGTATGAACAAGCGTTGGCTCCTATATCTCAAGAAAATCCTACAGGTG
TTGATCCTAGAGAGGATGTATCACCACAGTCTGCTTACTATCGGTTGAAAGATCAGCGTATGGCCGCCCG
CAACGCTGAACGTAATGCTCTTATAGAAGAAGAAAGTATCTATACCCACAGTAATTTATGGCGAGTATTT
ATTGAAGATGTCCCAGAAATACTCACGAATCAGTCTAAAGATTTGGAATTTGTTGCCTGGCTTATAGAAG
CCCTAACTCGATTGTATGGTTTTCGTGGTATGGGCGTTGGCTACAAACTCGCAACCAGTTTAATTGAGAA
CTTTTGGGATGATCTGTACCCAATGCCTGATGAAGATGGTATTGAGACAAGAATATCGGCGATTATTGGC
CTCAATGGTATCGATAGTGAAGGAACACTTATTTTTCCAATTGCTTGTATACCATTGACTGACTTAGGCG
TGGAGCAAGCTTATGCCTATTGGGAATATCAGCAAGCTATAGAGCTTGAGCGCTTAGACGAAGATAAGCG
CCGAAATCGAGTCGAGCTTGGGGCTGTTGAGCTATCTGAAATTATAACTACGGTTAAGTCGACTTCTGAT
ACGTTTTATCGAGAATTAATCACGGATTTGGAGTTCGCTACGGAATCATTTAATGAATTCAGTCAGCGAT
TAGATGAAGCGGTCGGTGATGTGACTCCTAGTTCTTATATATCAAAAAGACTTGAATCAATACACTCGGC
ATTAAGGCACCTTCTTGGAGATCGTTTTAATCAACCACAAGCAGTGATTGAAGAGCTAGAGGATCTTGAT
GAATCTTCTTCTGAACAACCGTTAAGTTCACAAAGTTGTGATGCATTATTAGCGACAAACATGAAATCAC
GAGAGCAGGCAATTAGACAATTGCAGCAAGTAGCTGATTTCTTCCGAGAGAGTGAACCTCACTCACCAGT
TTCTTACTCCATCGAACAGATCATTCGTTGGTGTGGGATGCCTCTGCCGGAGTTACTGGCGGAACTTATC
TCCGACGGGGATGCAAAGAAAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATTAA