SecReT6
Protein ID: 543974542
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4411
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1455989..1457281 [-]
Producthypothetical protein
NoteTssL
UniProt IDU2ZXH8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-63, Aligned region: 49..254
OmpA [PF00691], Evalue: 5.40E-14, Aligned region: 251..272
OmpA [PF00691], Evalue: 5.40E-14, Aligned region: 322..420
Protein Sequence: 430 a.a.     [Download]
>gi|543974542|ref|YP_008549288.1| hypothetical protein N646_4411 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MEQTIVKPTPGGRAPASKPQSEKFVDNTVVISKSPELVNNDSVVAYGSNSLLAEANGLLSIIGQIRSTAT
HSDPLFLKETLAQKLRDYENRLRQHDVDLDTIDTARYCLCCSLDEVVLNTNWGGHSFWSHDSLLSSFYAS
SQGGEAFFKHLDKCMAKPDANLDLLELMYVCLSLGFLGQYRLEKNGLESHRKLRRQVIATLKSYGRGVPQ
ELSNSIDQHILNGSKASDRAPLWVVCSVTAALLVCIYMYFSYELNKASNRTFSQLVNLIQPQQLNQDATS
ESKSAPIAEKISMYLATEIGKGLINVEPLQDRVRISLKSQDLFESGSADVVAYIQPVISKLARTLESTQG
KIIVTGHTDDRPIFTSKYPSNWHLSLARATAMSEQLISNSALEGRVIPEGLGDARPLVENSSDENRAINR
RIEIDLLVAN
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1457281-1455989 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGAACAAACGATAGTAAAACCAACACCGGGTGGAAGAGCACCCGCATCGAAACCACAATCAGAAAAGT
TTGTGGATAATACCGTAGTTATCTCAAAAAGCCCTGAATTGGTGAACAATGATTCAGTGGTCGCTTATGG
GAGTAACTCTCTACTAGCAGAGGCGAATGGCCTGTTATCTATTATCGGTCAAATTCGGTCGACAGCGACT
CATTCCGATCCGTTGTTTCTAAAAGAGACATTGGCACAAAAGCTTAGAGATTATGAGAACCGATTACGTC
AGCATGACGTTGATTTGGATACCATTGATACAGCTCGTTATTGTTTATGCTGTTCACTAGATGAAGTTGT
CCTTAACACCAATTGGGGTGGGCATTCATTCTGGAGTCACGATTCATTACTTAGCTCCTTCTATGCTAGC
AGTCAAGGTGGGGAAGCGTTTTTTAAGCATCTTGATAAGTGCATGGCGAAACCAGATGCGAACTTAGATT
TGCTTGAACTAATGTATGTGTGCTTATCTCTCGGGTTTCTGGGTCAATACCGTTTAGAAAAAAATGGACT
GGAATCGCACCGGAAATTGAGAAGACAGGTTATTGCTACTCTTAAGTCTTATGGGAGAGGAGTCCCTCAG
GAGCTAAGTAATAGTATCGACCAACACATTTTGAATGGCTCAAAGGCTTCTGATAGAGCCCCTCTTTGGG
TTGTATGTTCTGTAACGGCGGCATTATTGGTCTGCATATATATGTATTTTAGCTATGAGCTAAATAAGGC
ATCCAATCGCACCTTTTCTCAATTAGTCAATTTGATTCAACCGCAACAACTTAACCAAGATGCAACGTCA
GAATCAAAATCAGCGCCAATTGCAGAAAAGATTTCAATGTATCTAGCAACTGAGATCGGTAAGGGGCTAA
TCAATGTTGAGCCGCTGCAAGACAGGGTAAGAATTTCGTTAAAGTCTCAAGATCTATTTGAATCAGGTAG
TGCTGATGTTGTCGCTTACATCCAACCCGTTATTTCTAAGCTTGCGAGAACATTGGAGTCGACCCAAGGC
AAGATCATTGTTACTGGTCACACCGACGATAGGCCTATTTTCACGAGTAAATATCCCTCGAACTGGCACC
TATCATTAGCTCGAGCCACTGCTATGTCTGAACAACTGATCTCGAATAGTGCATTAGAAGGGCGAGTGAT
ACCCGAGGGATTGGGGGATGCAAGACCATTAGTTGAAAACAGTAGTGATGAAAACCGAGCTATTAACCGC
CGGATTGAAATCGACCTTCTTGTCGCGAATTAA