SecReT6
Protein ID: 543974543
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4412
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1457293..1458582 [-]
Producthypothetical protein
NoteTssK
UniProt IDU3AGJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-134, Aligned region: 7..427
Protein Sequence: 429 a.a.     [Download]
>gi|543974543|ref|YP_008549289.1| hypothetical protein N646_4412 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MFLRPQHFQQQERATSQEFKGLHQLGGVYNWGVCKCRVKKHALKDGLIELEHLEAVLPDMTLVNTLISND
SVSPLLIDKNTENTLVKITLPLSSVTGKNVSDVSESIVSRYVLQDIDVIDNLTGQDEETIQVAALNLELK
ASNDKLAGYVELPILRIKEVTPEGEVILDDEYVPPLINLLSDKVMSAYLRNVIAMTKMRADVIAQRLIKG
KSASASAVDFIMLQMLNRYEAKLKHFSELDRLHPLELATTLKGYIGELATFSNKTKRVPSLLAYDHLDVS
SVYSELNQILSQYLSVVLDQTATKLPLEPRQYGIQVTPLPDKRLLESCQFVLAIKADTTTDEIRRLVPAQ
LKFGPAEQIRDLINNQINGINVVPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGGIALHLSGHFPNA
ELELWSINQ
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1458582-1457293 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTTTTTACGTCCCCAGCACTTCCAACAACAAGAACGCGCAACCTCTCAAGAATTCAAAGGCTTACATC
AGTTAGGTGGGGTTTACAATTGGGGAGTTTGCAAATGTCGAGTAAAAAAACACGCGCTAAAAGATGGTCT
TATTGAACTTGAGCATCTTGAAGCTGTTTTGCCGGATATGACGTTGGTTAATACGTTAATATCCAACGAT
TCAGTTTCGCCTCTACTTATTGATAAAAACACTGAAAATACGTTAGTAAAAATAACTCTCCCTCTTTCAA
GTGTTACAGGTAAAAACGTTTCGGATGTAAGCGAATCGATCGTCTCTCGTTATGTACTTCAAGATATCGA
CGTGATAGATAACCTTACAGGACAAGATGAAGAAACCATCCAAGTTGCAGCCCTCAACCTTGAGTTGAAA
GCGAGTAATGACAAATTAGCGGGTTATGTGGAGTTACCTATCTTAAGGATCAAAGAGGTAACTCCTGAAG
GGGAAGTTATACTAGACGATGAGTACGTTCCTCCGCTTATCAATCTCCTGAGCGATAAAGTTATGTCAGC
TTATCTACGTAACGTTATCGCGATGACAAAGATGCGTGCTGACGTTATTGCGCAGCGCTTGATTAAGGGC
AAATCTGCATCGGCATCTGCTGTTGATTTCATCATGCTCCAAATGTTGAACCGATATGAGGCGAAGTTAA
AGCATTTCAGTGAGTTAGATAGGTTACATCCACTGGAATTAGCGACGACACTTAAAGGTTACATTGGTGA
GTTAGCCACTTTTTCTAATAAAACTAAAAGAGTCCCAAGTTTGCTTGCGTATGATCACTTAGATGTATCA
AGTGTTTATAGCGAGTTGAATCAGATACTCAGTCAGTACCTCAGTGTTGTTCTTGACCAAACTGCGACCA
AACTTCCGTTGGAGCCTCGCCAATACGGTATTCAAGTGACGCCGCTTCCAGATAAACGCTTGCTTGAGTC
ATGCCAATTTGTGCTAGCAATTAAAGCAGATACCACAACAGATGAAATAAGACGCCTGGTCCCAGCGCAA
CTCAAGTTTGGCCCGGCAGAACAGATTCGCGATCTAATTAATAATCAGATCAACGGTATAAACGTAGTGC
CGTTGAGTGTCGTCCCGAGACAGATTCCTTACCAAACGGGCTATGTCTATTTCGAAGTTGTCAAGAAAGG
GCCATTTTGGATGAGGCTAAAAGATAGTGGCGGTATTGCGCTTCACCTATCAGGGCATTTTCCTAATGCT
GAACTTGAGCTTTGGAGTATTAATCAATAG