SecReT6
Protein ID: 543974544
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4413
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1458640..1459095 [-]
Producthypothetical protein
NoteTssJ
UniProt IDU3C1N4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-39, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|543974544|ref|YP_008549290.1| hypothetical protein N646_4413 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MKKFYQYILLLISMALFGCSAANLVVDPYSDLEIAASHNINPDSNGRPSPVVVYVFELTSNTIFESQDFF
SIYEESEKVLGPDLVNKYEVSLTPGQKETYQASMSPKTEYLGIVVAFRDIENSNWRQVIKVDKTGYNTYQ
VLLEDLSLVVK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1459095-1458640 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAAAAAGTTTTACCAATATATTTTGTTATTAATTTCAATGGCTTTATTTGGGTGCTCAGCAGCGAACC
TAGTTGTTGATCCATACTCAGATTTAGAAATAGCAGCAAGTCATAACATTAATCCTGATTCAAACGGCAG
GCCTTCTCCTGTAGTGGTGTATGTATTTGAATTAACGTCAAATACCATTTTCGAAAGCCAGGACTTTTTT
TCTATTTATGAAGAAAGTGAAAAAGTCTTAGGACCTGATTTAGTGAATAAATATGAAGTTTCATTAACTC
CAGGTCAGAAAGAAACATATCAAGCAAGTATGTCTCCAAAGACAGAATATTTAGGCATTGTCGTAGCGTT
TCGAGATATTGAAAACTCAAATTGGCGACAAGTCATTAAAGTGGATAAGACCGGTTACAACACATATCAA
GTATTGTTAGAAGATCTGTCTTTGGTCGTTAAATAA