SecReT6
Protein ID: 543974545
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4414
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1459107..1460300 [-]
Producthypothetical protein
NoteFha
UniProt IDU3BSP1
KEGG IDvag:N646_4414
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-15, Aligned region: 32..101
Protein Sequence: 397 a.a.     [Download]
>gi|543974545|ref|YP_008549291.1| hypothetical protein N646_4414 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVVSGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPVGQGNEIALSNDDMVSLGDYQISVSVQTDTDVFSLETSKSLSSAPPEVVSSPSEEEF
VDLGLSASELLNESVPSDFQLDIGLVDDFIDIPKPKKQSTVSETLPKVNRQSEHLSTPNFDTNGGELAAF
VRGVGIDPMMIPSDNREEWFEQLGESFSLMLVGLMETLHNRAVFKQTNRLSHTAFRKSENNPLKFSANLE
DAIHNLYNRQTASFLKPNAAIKEAFNDIESHEQALMKGVEGTVSSVMSLVEPTSIYSDALAKDTVINKVI
PARKYAQSWKRFEDIHEKLSDDIINKESPFYLEDFAKHYELALKNKG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1460300-1459107 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAAGTTGGTTTTAACCATAACAAGTTTTCACAAATTTACTCCAGAGATTGAGAGTGAGTTCGTGTTTG
AATCAAGTGATGAACATGCCAAGGTTACATTTGGTAGGTCTGAACAATGTGATTGGACACTACCAGATCC
TGAAAGAGTGGTATCCGGAACCCACGGAGAACTGATTAAGTTTGGTGACAAATACTTGATAAAAGACCTC
TCAACGAATGGTACTTTTGTAAATAATGCTGTAACTCCTGTGGGTCAAGGAAATGAAATAGCACTAAGCA
ATGACGATATGGTTAGCTTAGGGGATTATCAAATTTCAGTTTCTGTTCAAACAGATACAGATGTATTCAG
CCTTGAGACAAGTAAAAGTCTTTCTAGCGCCCCCCCTGAAGTAGTCTCAAGTCCATCGGAAGAGGAATTT
GTTGACCTAGGCCTTAGTGCTAGTGAACTCTTAAACGAAAGTGTTCCTTCTGACTTTCAGCTAGATATTG
GTTTAGTCGATGATTTTATTGATATCCCAAAGCCCAAAAAACAGAGCACCGTATCTGAAACTTTACCGAA
AGTTAACCGACAATCAGAACACCTATCGACTCCCAACTTTGATACCAATGGGGGTGAACTTGCGGCTTTT
GTTAGAGGGGTGGGTATAGATCCAATGATGATTCCCAGCGATAACCGAGAGGAATGGTTTGAACAACTGG
GGGAGTCATTTTCTTTGATGCTAGTTGGTTTAATGGAAACACTGCATAACAGAGCAGTGTTTAAGCAAAC
AAATCGACTTAGTCATACCGCATTTCGTAAGTCAGAAAATAACCCTTTAAAGTTTTCTGCAAACTTAGAA
GATGCGATTCATAACTTATATAACCGTCAAACGGCTAGCTTCTTAAAGCCAAATGCAGCCATTAAAGAAG
CATTTAATGACATCGAAAGTCATGAGCAAGCCTTAATGAAAGGTGTTGAAGGTACGGTTTCGAGTGTTAT
GTCACTTGTTGAACCTACTTCTATATACTCAGATGCTTTAGCGAAAGACACGGTTATTAATAAGGTTATT
CCAGCTAGAAAATATGCTCAAAGTTGGAAGAGGTTTGAGGATATTCATGAAAAGTTATCCGATGATATTA
TCAATAAAGAGTCTCCGTTCTATTTAGAAGACTTCGCTAAGCACTATGAATTAGCATTAAAAAACAAAGG
CTAG