SecReT6
Protein ID: 544391329
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14315
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3006772..3007272 [+]
Producthypothetical protein
NoteTssB
UniProt IDT2G183
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|544391329|ref|YP_008565930.1| hypothetical protein LY180_14315 [Escherichia coli LY180]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLSGSGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3006772-3007272 Escherichia coli LY180, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCTGTTGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGTGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGACACACTAAGCGGAAGCGGTAATGAGCAAAATATCGCGCTTG
AATTTAAAAGCCTGAAAGATTTTGAACCCGAACAGGTAGCAAAAAATATCCCACAGCTTCGTGTATTACT
CGCTATGCGCAATTTATTACGTGACCTGAAATCCAATCTGTTAGATAACGCAACGTTTCGACGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA