SecReT6
Protein ID: 544393080
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14320
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3007331..3008869 [+]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDT2G736
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|544393080|ref|YP_008565931.1| EvpB/family type VI secretion protein [Escherichia coli LY180]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGENVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFSNLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3007331-3008869 Escherichia coli LY180, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTGACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACACTGGCGGATGCCTCACCCGATGAGCGCGTGACAGCGGCGATTCACGTTCTACTTTCCTGT
CTGGCGAAATCAGGCGAGAACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATTTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCATCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAATCGTTTCGTGATACCGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTATCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAAGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTTCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCCTATATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGTAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA