SecReT6
Protein ID: 544393081
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14325
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3008887..3010224 [+]
Producthypothetical protein
NoteTssK
UniProt IDT2G5Y6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|544393081|ref|YP_008565932.1| hypothetical protein LY180_14325 [Escherichia coli LY180]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALELGSLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVSLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRA
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3008887-3010224 Escherichia coli LY180, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGATGTCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCTGACGTGAGCGATGTTCTGCCTCTCGCCTGCGATCTGCACGCGCTGACGAACG
ACAGCGCGGTTGTTCTGCTGGCGCTGCCGCTTGCCCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTACGCTATCGTCAGGAATGGCAAAAGGTACAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGTTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGACTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGTCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGTTGCTTAACGCGCTGAACTCCGCCGAGCCGGTGCTGAGTGATTTCCTGCGCTACCCGGC
GGTTCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGGGCGCTGCTGACATTTTCCCTTGAA
CATAACGTCAGCGCCGTCCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCACTGGAGCTGGGATCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTTCACTGGTGCCACTGACCTCAGTTCCGGCGGCGCT
GCCGCTGCGACTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCAGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCGCATGA