SecReT6
Protein ID: 544393082
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14330
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3010221..3010886 [+]
Producttype VI secretion protein ImpK
NoteTssL
UniProt IDT2G678
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-48, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|544393082|ref|YP_008565933.1| type VI secretion protein ImpK [Escherichia coli LY180]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3010221-3010886 Escherichia coli LY180, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGTCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTTAGCCGGGAGAGCGTGGAGCACATTACCTACGCGCAGTGCGCCCTG
CTGGACGAAACAGTCCTGAGTCGCAGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCAGGCGAGCTGCTGTACGAGCGGATGAAGCAGGTGTTGCAGGA
GCCCGCGCCTGCACAGGCTGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGTGGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCTGGTCGCGCCATTTGGCG
TACTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTAACGCTGACGCTGCTACTGGCCGGTGTCTGGTGGGGGCTGCACCACTGGCTGAACGTG
CTGGTGGATGAATTGCTGCCGCAAAGCCTGCGGTAA