SecReT6
Protein ID: 544393083
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14335
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3010899..3012551 [+]
ProductOmpA family protein
NoteTagL
UniProt IDT2G556
KEGG IDecol:LY180_14335
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.10E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|544393083|ref|YP_008565934.1| OmpA family protein [Escherichia coli LY180]
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTVMPGMYR
DAAVLTGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPEKAHSPWLICTGGEIQVATSAETASPAQW
LTQTSTQERSQPLCYLLKAESLMQWLNLYVLAALNGPEAKCPPLAMAVGLHPSLPAVDNNLWQLWITART
GLTTDIADTGTDATLPFPDALLRRLPRQSGFTPLRRASVTMLGITTVAGIAALCLSATANHQLLRHIGDD
LHQFYAVPAEEFITKARRLSVLKDDAVMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDTLVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3010899-3012551 Escherichia coli LY180, complete genome
GTGAGGAACACGCTGAAACAGGCCGTCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCGGTGT
TTATCAGTCCGTCTGGCGTACTGAGATGGGCCGGGGCGGCGGCTATCGTTCTGGCGGTTGCCGCGTTGCT
GATTTACCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACGTACCGACAACCGGTAGTGCTGGTCTGTGGCGATATGTCGGCGCATCTGTTCACTGACAGCCCGGTCC
GGCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCCGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
ACTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCGTCATGCCCGGCATGTACCGG
GATGCGGCGGTTCTGACCGGACGACTGCGACGGTTCGCCCACAGTATGGCGACAGTGCGTCGCCGGGCGG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCCTTGCCGGAGAAGGCACATTCACC
GTGGCTTATCTGTACCGGCGGCGAAATTCAGGTAGCGACGTCTGCTGAAACCGCCTCCCCCGCGCAGTGG
CTCACGCAGACCAGCACACAGGAGCGCAGCCAGCCACTCTGTTACCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGAATCTTTATGTGCTGGCGGCACTGAACGGCCCGGAGGCGAAATGCCCGCCACTGGCGATGGC
CGTGGGGCTACACCCCTCGTTGCCTGCAGTGGATAACAACCTGTGGCAGCTGTGGATCACCGCCAGAACC
GGCCTGACGACGGATATCGCGGACACCGGCACAGACGCCACGCTGCCGTTTCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCAGTGTAACCATGCTGGGCATCACCACCGT
GGCGGGTATCGCCGCGCTGTGTCTGTCAGCCACGGCGAATCACCAGTTATTACGGCATATCGGTGACGAT
CTGCACCAGTTTTATGCCGTTCCGGCGGAGGAATTTATCACCAAAGCCCGTCGTCTGTCGGTGCTGAAAG
ACGATGCGGTCATGCTCGATGGGTATTACCGGGAAGGAGAACCGCTGCGTCTCGGTCTGGGGTTATACCC
CGGCGAACAAATCCGCCAGCCGGTATTACGCGCCATTCGTGACTGGCGTCCGCCTGAGCAAAAAATGGAA
GTGACAGCCTCGCTTCAGGCGCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACACACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
TATCCTCGTGGCCGGATATACCGACGCCACCGGCGACGAAAAAAGCAATCAGCAGTTATCACTGCGACGT
GCCGAAGCGGTGCGTAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGTGAGAGCCAGCCTGCGGCGACCAACGATACGCCACAGGGCCGGGCAGTCAACCGGCGCGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA