SecReT6
Protein ID: 544393085
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14350
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3015948..3018434 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDT2G741
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-61, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 3.30E-46, Aligned region: 606..743
T6SS_Vgr [PF13296], Evalue: 1.70E-33, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 3.50E-14, Aligned region: 392..473
Protein Sequence: 828 a.a.     [Download]
>gi|544393085|ref|YP_008565937.1| type IV secretion protein Rhs [Escherichia coli LY180]
MGIQNFDHSHHKLKIRGQQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNLTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMADIISELNGLSDKIQKLSDDATMANADPADMAAQIALITSRINDLTAPVILMHAPKGVAVASGEHL
QLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIKLIANKGAVSVQAQHDLMELLAKKSIEIV
STEDEIRISAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKAVHYGRQPGAKLKQEMMAFPMIESGEFNT
RFFFTDDNDIPYANTKYIARLPDGTTKDGITSDDGRSEIFFSDKDGEILIHLFVEQDK
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3015948-3018434 Escherichia coli LY180, complete genome
ATGGGTATTCAGAATTTCGACCACTCGCACCACAAGCTCAAAATTCGCGGCCAGCAAAGTCCGGTGGATG
TGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGATATCCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCCCCCCTGCGCACCCTGTACGGGGTCATTACCGGTTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTGGAGCCGCGTATGGCGCTGCTGGCCCGCAGCCGCCAGAA
TGCCATCTACCAGAATCTGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCCGGTGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACACGACTC
GGCACACACTGACCATGTGACCATCCAGAACTACAAGCGCAACGTTCTGCGCACCCCTGCCAATAACAAA
ATCCGGCTGGATGATGAGCGCGGTAAAGAGCATATCAAGGTCAGTACCGAATATGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTTGTTGATGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGTGCGGTGCGGGCAAAGAAAGGCATCTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGTCAG
GTCAGAGAGATGGCCGACATTATCAGCGAACTGAACGGCCTGAGCGATAAAATCCAGAAACTGTCCGATG
ACGCGACGATGGCGAACGCCGACCCGGCGGATATGGCCGCGCAGATAGCATTGATAACCAGCCGGATAAA
CGACCTGACCGCCCCGGTGATTTTGATGCACGCGCCGAAAGGTGTGGCGGTCGCCAGCGGCGAGCACCTG
CAACTGGCAGCGGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGGCGTGGTGAAGAATA
TGTTTATCGGCGTGGGGCGGGCGCTGAGCGTGTTTGTGCGCAAGGCGGGTATCAAACTGATTGCCAATAA
AGGCGCAGTATCGGTACAGGCGCAGCACGATTTGATGGAGTTACTGGCGAAGAAGTCGATAGAGATCGTC
AGTACCGAAGATGAGATCAGGATTTCAGCGAAGAAAAAAATAACGATTAATGGCGGTGGAAGTTATATCC
GGATTGAGGGTAGCGGCATTGAGCCAGGAACGCCGGGGGATTATAACGTCAAAGCGGTGCATTATGGGCG
TCAGCCGGGAGCGAAGCTGAAACAGGAAATGATGGCGTTTCCGATGATTGAATCTGGAGAATTTAATACC
CGTTTCTTTTTTACAGATGATAATGATATTCCTTATGCAAACACCAAATATATAGCAAGATTACCAGATG
GTACAACAAAAGACGGCATTACAAGCGATGATGGTCGATCAGAAATATTTTTTTCTGATAAGGATGGGGA
AATATTAATACATCTATTTGTCGAGCAGGATAAATAA