SecReT6
Protein ID: 544393088
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14365
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3020138..3022645 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDT2G559
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.50E-62, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 1.50E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 7.20E-35, Aligned region: 480..584
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 835 a.a.     [Download]
>gi|544393088|ref|YP_008565940.1| type IV secretion protein Rhs [Escherichia coli LY180]
MDILVFDHSYHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIALLQQSVKDLTQAVILLSAPKGVAIASGEHL
QLAASKNVIANAGNNADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQ
SFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3020138-3022645 Escherichia coli LY180, complete genome
ATGGACATACTTGTTTTTGACCACTCGTACCACAAACTCAAAATCCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCACCCCTGCGCACCCTGTACGGCGTCATCACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTTGAACCCCGTATGGCGCTGCTGACCCGCAGCCGCCAGAA
TGCCATTTACCAGAACCAGACTGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCGAACAACAAA
ATCCGCCTCGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGT
TGAATCTGGGTCATCTGGTGGATGCCGGAAAACAACAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGGCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGCAGTCGCTGTCCACTG
ATGCGCAGACGACGAATGCCGATCCGGCAGATCTGTCATCGCAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACGCAGGCCGTGATCCTGCTAAGTGCACCCAAGGGCGTGGCGATCGCCAGCGGCGAGCACCTG
CAACTGGCGGCGTCGAAGAATGTGATAGCGAACGCAGGCAACAACGCAGATATCGGCGTAGTAAAAAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGTAAAGCGGGCATCAAGCTGTTTGCCAATAA
AGGGGCGGTCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGAGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATATTACGGGCG
TAAACCAAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTTAATCAG
AGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAACTGGAAA
GTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAAGGAGGA
GGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGACATTAATTAA