SecReT6
Protein ID: 544393093
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14390
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3028495..3030105 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2G565
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 66..126
Protein Sequence: 536 a.a.     [Download]
>gi|544393093|ref|YP_008565945.1| hypothetical protein LY180_14390 [Escherichia coli LY180]
MSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNKLSGADTDLI
CQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSS
IPAASSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLVP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAVIRQDLALLL
ERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFEVKARQ
LKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3028495-3030105 Escherichia coli LY180, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAAATACGCCGGTCGGGGAAGACCCCGG
CTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAACTTTCCGGCGCGGATACGGACCTCATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCTGGCGCTGCTGGCCGGACTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAAATGGCGCTGGAGTGGCTGGCAGGGGAA
AAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGAACATTGTTGCCGCTC
TTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAACAACAGTCTCCCTCCCTGATGCCGCTGAT
TAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAACGCGGTGGTGCCGCAAAACAGCAGCAGC
ATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAGACCATCACCTCCGGGCGCGACCTGCTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCGGCGCACCGGCTGAT
GAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGATGTGGACGGCAAAACCCGGCTGGTCCCG
CCGCGCACCGAGTCACGCAATCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACTGGCGTCAGCCATTTCTGGCTGGACATTCAGTGGTATCTGCATCAGGC
GCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCGGTTATCCGTCAGGACCTGGCGCTTCTGCTG
GAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCACACCGTTCGCCGACGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAAAGCCGCTGTGCCGAC
AGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCAGACAGTCAGGGCGTG
GAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACTGCACGACAGCGCCTGTTATTGCGAC
TGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCTGCTGGAAGAACTGGA
TACTGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCGGAACTGCTGTTTGAGGTAAAAGCCCGGCAA
CTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCTGATAAAGCCCTGCTGAACCGAAAAATGGAAATCC
TGCTGGGAACGCTGGTAACAATCGATCCGGTACGGGCAGCGGTACTGTGTGATACGCAGCATAAGGAGTG
A