SecReT6
Protein ID: 544393093
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14390
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3028495..3030105 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2G565
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 66..126
Protein Sequence: 536 a.a.     [Download]
>gi|544393093|ref|YP_008565945.1| hypothetical protein LY180_14390 [Escherichia coli LY180]
MSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNKLSGADTDLI
CQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSS
IPAASSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLVP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAVIRQDLALLL
ERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFEVKARQ
LKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3028495-3030105 Escherichia coli LY180, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAAATACGCCGGTCGGGGAAGACCCCGG
CTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAACTTTCCGGCGCGGATACGGACCTCATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCTGGCGCTGCTGGCCGGACTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAAATGGCGCTGGAGTGGCTGGCAGGGGAA
AAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGAACATTGTTGCCGCTC
TTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAACAACAGTCTCCCTCCCTGATGCCGCTGAT
TAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAACGCGGTGGTGCCGCAAAACAGCAGCAGC
ATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAGACCATCACCTCCGGGCGCGACCTGCTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCGGCGCACCGGCTGAT
GAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGATGTGGACGGCAAAACCCGGCTGGTCCCG
CCGCGCACCGAGTCACGCAATCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACTGGCGTCAGCCATTTCTGGCTGGACATTCAGTGGTATCTGCATCAGGC
GCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCGGTTATCCGTCAGGACCTGGCGCTTCTGCTG
GAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCACACCGTTCGCCGACGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAAAGCCGCTGTGCCGAC
AGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCAGACAGTCAGGGCGTG
GAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACTGCACGACAGCGCCTGTTATTGCGAC
TGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCTGCTGGAAGAACTGGA
TACTGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCGGAACTGCTGTTTGAGGTAAAAGCCCGGCAA
CTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCTGATAAAGCCCTGCTGAACCGAAAAATGGAAATCC
TGCTGGGAACGCTGGTAACAATCGATCCGGTACGGGCAGCGGTACTGTGTGATACGCAGCATAAGGAGTG
A

Protein ID: 544393098
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14415
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3032130..3033488 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2G567
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 1..42
ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 375..393
Protein Sequence: 452 a.a.     [Download]
>gi|544393098|ref|YP_008565950.1| hypothetical protein LY180_14415 [Escherichia coli LY180]
MRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAK
EDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSSIPAASSPVDAPQVQ
TITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYA
QQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLLERLPGLENLAWNDG
TPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGVEAALGWIQTRPGIT
TARQRLLLRLLMARVAEQYGKNEMALLLLEELDTVAQGLTLTQWEPDLLFEVKARQLKLLRLRAHRYADK
ALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3032130-3033488 Escherichia coli LY180, complete genome
GTGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGC
TGGCGCTACTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAA
AATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAA
GAGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAAC
AACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAA
CGCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAG
ACCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGC
AGGGCTGGCTTTCGGCACACCGGCTGATGAAAACCCTGCGCTGGGACACAGTGCATGAACTGCCGCCGGA
TGTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCG
CAGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGC
TGGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGT
TATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGC
ACACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCAT
GGCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGC
ACTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCTCTGGGCTGGATACAGACCCGTCCGGGCATCACC
ACGGCACGCCAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAAA
TGGCGCTCCTGCTGCTGGAAGAACTGGATACCGTCGCACAGGGGCTGACGCTGACGCAGTGGGAGCCGGA
CCTGCTGTTTGAGGTAAAAGCCCGACAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCGGATAAA
GCCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGACAATCGATCCGGTACGGGCAGCGG
TATTGTGTGATACGCAACATAAGGACTGA

Protein ID: 544393105
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14455
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3040900..3042276 [+]
ProductimpA family protein
NoteTssA
UniProt IDT2G760
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 42..100
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 358..376
Protein Sequence: 458 a.a.     [Download]
>gi|544393105|ref|YP_008565958.1| impA family protein [Escherichia coli LY180]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRRVEKLSLALFRQNGVELQTQVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMKQPEKSEESPQPVFAT
RPAQQNDKDASPSAPSPEISRQRTWPIFMAGMVVMACLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSTEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3040900-3042276 Escherichia coli LY180, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTACAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCTGATGTGGACTGGCGTCGGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAATTACAGACGCAGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGACATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGTTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATTTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGTAATACGGCGCTACGTCTGGAGCGGCTGGCACCACAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAAGCAACCAGAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACC
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCATCCGCGCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCTGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCACTAATCCAGCGAATACAACTGTCTGTCATGCCATTACCGCAGTCGCTG
GAGAGCGGCGAGCTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGAGCGCTGAACGCGCAGTGGCGTAAA
CAGCGGGAGCTGAGCGCCCTGTCCACAGAGGCATTGAATGGCTACGCACAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCGACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTAATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA