SecReT6
Protein ID: 544393094
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14395
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3030105..3031028 [+]
ProductPaar
NotePAAR
UniProt IDT2G6E7
KEGG IDecol:LY180_14395
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.70E-11, Aligned region: 11..68
Protein Sequence: 307 a.a.     [Download]
>gi|544393094|ref|YP_008565946.1| Paar [Escherichia coli LY180]
MTMGRGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGT
LDSQSSCPCKARFIASMMDDTYETKEGSGTDNQIAGIDQNRLNKEWTDVRGDNTQKKTKYTSEIILITST
IRVYSTNAEVMGDHSAIYFEVSGDSSSPYLYDPNGSYNPYKKLENGNGQRGSGFVFSGEFAKLDDFISYQ
ENPNEVTQNKLDSEWFPYKVKLLSLPVTNDELLTIKNAALALDDGDEEPGSFSCAEWSSKLLKYIIPELD
IYTLPNSLWEAVVKEKEKRIKLNGENK
 
Nucleotide Sequence: 924 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3030105-3031028 Escherichia coli LY180, complete genome
ATGACGATGGGAAGAGGCTATTTTCTGGTCAGGGGCGATAAGACCACCTGCGGCGGGAAGATTATTGAAG
GCGCGGACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATA
TCCGGGAATGTTTATTATTGTGGGCGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACG
CTGGACAGTCAGAGCAGTTGCCCGTGTAAGGCGCGATTTATTGCGTCAATGATGGATGATACGTATGAGA
CCAAAGAAGGTTCAGGAACAGATAACCAGATAGCAGGAATAGATCAGAATAGGTTAAATAAAGAATGGAC
GGATGTTCGAGGAGATAACACTCAGAAAAAAACAAAATATACATCAGAAATAATTTTAATTACATCCACA
ATTAGAGTATATAGTACTAATGCCGAGGTAATGGGAGATCATTCAGCTATTTATTTTGAAGTGTCTGGTG
ATTCATCAAGCCCTTATCTTTATGATCCTAATGGAAGCTATAATCCTTATAAAAAATTAGAAAATGGAAA
TGGGCAGAGAGGATCCGGTTTTGTATTTAGTGGTGAATTTGCAAAACTGGATGATTTTATCAGTTATCAA
GAAAATCCGAATGAAGTAACGCAGAACAAGCTGGATAGCGAATGGTTTCCCTATAAGGTAAAGTTATTAT
CTTTACCGGTAACGAATGACGAGTTATTAACGATAAAGAATGCTGCATTGGCATTAGATGATGGCGATGA
AGAACCGGGGAGTTTTAGTTGTGCCGAATGGTCTTCAAAATTGTTAAAATATATAATCCCAGAACTTGAT
ATTTATACGCTGCCAAATTCACTATGGGAAGCGGTTGTTAAAGAAAAAGAAAAAAGAATAAAGTTAAATG
GCGAGAATAAATGA