SecReT6
Protein ID: 544393098
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14415
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3032130..3033488 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2G567
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 1..42
ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 375..393
Protein Sequence: 452 a.a.     [Download]
>gi|544393098|ref|YP_008565950.1| hypothetical protein LY180_14415 [Escherichia coli LY180]
MRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAK
EDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSSIPAASSPVDAPQVQ
TITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYA
QQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLLERLPGLENLAWNDG
TPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGVEAALGWIQTRPGIT
TARQRLLLRLLMARVAEQYGKNEMALLLLEELDTVAQGLTLTQWEPDLLFEVKARQLKLLRLRAHRYADK
ALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3032130-3033488 Escherichia coli LY180, complete genome
GTGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGC
TGGCGCTACTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAA
AATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAA
GAGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAAC
AACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAA
CGCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAG
ACCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGC
AGGGCTGGCTTTCGGCACACCGGCTGATGAAAACCCTGCGCTGGGACACAGTGCATGAACTGCCGCCGGA
TGTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCG
CAGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGC
TGGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGT
TATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGC
ACACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCAT
GGCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGC
ACTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCTCTGGGCTGGATACAGACCCGTCCGGGCATCACC
ACGGCACGCCAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAAA
TGGCGCTCCTGCTGCTGGAAGAACTGGATACCGTCGCACAGGGGCTGACGCTGACGCAGTGGGAGCCGGA
CCTGCTGTTTGAGGTAAAAGCCCGACAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCGGATAAA
GCCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGACAATCGATCCGGTACGGGCAGCGG
TATTGTGTGATACGCAACATAAGGACTGA