SecReT6
Protein ID: 544393102
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14440
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3038872..3039951 [+]
Producthypothetical protein
NoteTssG
UniProt IDT2G698
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|544393102|ref|YP_008565955.1| hypothetical protein LY180_14440 [Escherichia coli LY180]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDNPATDAVRFRPHPGMGFPVSELKNV
ERDAGNPDVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3038872-3039951 Escherichia coli LY180, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAACCC
CGCCACCGATGCGGTGCGCTTTCGTCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGCGGGCAATCCCGACGTGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCTATGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTTATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTACCTGGCGGGCAGCTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGCGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTATCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA