SecReT6
Protein ID: 544393104
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14450
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3040496..3040900 [+]
Producthypothetical protein
NoteTssE
UniProt IDT2G6F5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-16, Aligned region: 17..106
Protein Sequence: 134 a.a.     [Download]
>gi|544393104|ref|YP_008565957.1| hypothetical protein LY180_14450 [Escherichia coli LY180]
MLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGIHGLMRQIE
ETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQERAY
 
Nucleotide Sequence: 405 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3040496-3040900 Escherichia coli LY180, complete genome
ATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCAGCGAGCGGGATCAGCTTATCCTTT
CCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCACACTGGCGCATTTGCCGGATTACGG
TCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATTCATGGCCTGATGCGTCAGATTGAA
GAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGGAGTTACTCCCCCAGCCCCGTCCGG
GGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTGGATACGCTTTGATGGCGTGTTTTC
TCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGGGCGTACTGA