SecReT6
Protein ID: 549478369
SecReT6 ID854
T6SS typei3
Gene symbol-
Locus tagIA1_01460
StrainSalmonella enterica subsp. enterica serovar Thompson str. RM6836
Repliconchromosome [GenBank: NC_022525] [Browse all T6SS(s) in this replicon]
Location [Strand]328583..330091 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV5KF91
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-191, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|549478369|ref|YP_008612117.1| EvpB family type VI secretion protein [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITVSDDAYKSISA
IIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWD
QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQE
LANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDANGSDHTKYV
WSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRL
VTKLPSVKQGNA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|549478129|ref|NC_022525.1|:328583-330091 Salmonella enterica subsp. enterica serovar Thompson str. RM6836, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGCAACAGGCGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCT
ATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGA
AGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAAT
TCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGAT
CAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTA
TCATTGCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGC
CGCGTCGGCCCATGCGCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAG
CTGGCGAATCCCCGCGACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGC
GGGCTAGCGAAGACTCCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGC
AAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGAATGGTTCTGACCATACCAAATACGTC
TGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGT
TGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGG
CGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAAC
GGTTTTATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAATCGCTGCAAA
AACCACAGGAATACTACGATCCGGACGCGACGGCCAACGCCAACCTGTCCGCCCGTCTGCCGTACCTGTT
CGCCTGCTCGCGCTTCGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGT
GAGGATATGCAGCGCTGGCTAAATGAATGGATTATGAATTACGTCGACGCCGATCCGGTGAACTCCTCGC
AAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGG
TTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTG
GTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA