SecReT6
Protein ID: 549478380
SecReT6 ID854
T6SS typei3
Gene symbol-
Locus tagIA1_01535
StrainSalmonella enterica subsp. enterica serovar Thompson str. RM6836
Repliconchromosome [GenBank: NC_022525] [Browse all T6SS(s) in this replicon]
Location [Strand]345023..347212 [+]
Producttype VI secretion protein Vgr
NoteTssI
UniProt IDV5KFP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-80, Aligned region: 121..429
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 467..559
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 663..685
Protein Sequence: 729 a.a.     [Download]
>gi|549478380|ref|YP_008612132.1| type VI secretion protein Vgr [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTCEVFRPQRTVSKPHTKGPQSAIVTGPSGQEIWTDQYGRVK
VQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETN
SIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVM
QLIGKGIDMNPDGGTAVTADDIAPLPTSE
 
Nucleotide Sequence: 2190 bp     [Download]
>gi|549478129|ref|NC_022525.1|:345023-347212 Salmonella enterica subsp. enterica serovar Thompson str. RM6836, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAAGCCGCTGTGGA
ACAGGCTGCGGGATCGCTGTTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTAGCAGCG
GCGCAGGCTGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCTGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGCTGAAACTGCTGACCCATACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGACTGGACAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGTTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAATACCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCGACCTGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATTGTCACCGGCCCGTCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTGCAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAAGACACCATGCCGCCGTGGGGA
CTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAATGGCAACA
TGCTGCGTTTTGACGACAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACACCAC
GGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACCAAC
AGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGACGA
TCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGCGCT
TGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTCATG
CAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTGCCC
CCCTTCCCACCTCTGAGTGA