SecReT6
Protein ID: 549481708
SecReT6 ID854
T6SS typei3
Gene symbol-
Locus tagIA1_01430
StrainSalmonella enterica subsp. enterica serovar Thompson str. RM6836
Repliconchromosome [GenBank: NC_022525] [Browse all T6SS(s) in this replicon]
Location [Strand]320807..322690 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV5KPF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|549481708|ref|YP_008612111.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIKPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|549478129|ref|NC_022525.1|:c322690-320807 Salmonella enterica subsp. enterica serovar Thompson str. RM6836, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGCTACCTGCGGGAGACCGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGGCTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGCACTCAGCTAAAAATTGACGCCGAGTTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAGCCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCCGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCTATCCCGGAAGGTGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACTCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCGCCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGACTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTGCATACCAGCGCCGTCGCCACACTGGCCGGTGAGCCCGGACACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTGCCGCTCGCCTGGAACGTGTT
TCACGGCCATAATCTGCTGCATGAATTTTTCGCCTGTCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGGTTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTCATACTGCTTAACCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCTGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCCCGCACCACCACCCGGATTGAAGTTACTCACAGCGTGACGGAACAGCATCTGGTGGTGGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTTCAGGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAGCCGCGCCGCTCGTCAGAAAACGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
GTCTTCCTGTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGCCTTATTCCACGTAATGGCCGGGATGATCTGACCGTAGATGC
GGCGATTCCGGTGGCGGGCGTAGGTCTTATCAAACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAATCTGTTTATTCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCGGTGACCCGCCGCCTGCCCGGCTCCGGCCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAGGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTCAGAACCGGGCAACGGGGGAGCGTATGA