SecReT6
Protein ID: 549555030
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2911
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2962566..2963528 [-]
Producthypothetical protein
NoteTssG
UniProt IDS5Z9L7
KEGG IDkpj:N559_2911
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-66, Aligned region: 2..279
Protein Sequence: 320 a.a.     [Download]
>gi|549555030|ref|YP_008425856.3| hypothetical protein N559_2911 [Klebsiella pneumoniae JM45]
MGGTSHPADDPVRFYPHPGMGFPASELKAVEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHRE
GHEALQGLLDIFSHRIMTQFYRIWRKYSWPATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLAL
TGVLRQPGKTQQGIQALVTLLAPETTVRVSPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQL
LVALTTDNPAEAQGWKPDGPLFRDFLILLRVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGV
GDGESEGDIPQTFTTELGTYTGLQPATFLQGNRRVTYKFD
 
Nucleotide Sequence: 963 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2963528-2962566 Klebsiella pneumoniae JM45, complete genome
ATGGGGGGAACCAGCCATCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGAATGGGATTTCCCG
CCAGCGAACTGAAAGCCGTGGAATACGATGAGGCCGATGACAGCAGGCCGCCGGTCATTCGCACCACCTT
TATGGGGTTGTACGGTGTCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCACAGGGAA
GGGCATGAAGCGCTGCAGGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCT
GGCGGAAATACTCCTGGCCCGCCACCTTTGAGCCCGGCGGCACCGATCGTCTCTCGCAGTCGCTACTGGG
CCTGGCGGGGCTAGGCATCCCCGGCACGACGCAGCATATCGCCTCGCCGGCGTCGCGCTTTCTGGCGCTA
ACCGGCGTGCTGCGTCAGCCGGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGG
AGACCACCGTCAGGGTGAGCCCGTACAGCCTGCGTCCGGTGGCGATCAGCCAGCCGCTGGGGTTTTACGG
CGATGACGACTTCTTCCTGGACGGCAATACGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTC
CTCGTCGCCCTTACCACCGACAATCCCGCGGAGGCGCAGGGCTGGAAGCCTGACGGCCCGCTGTTTCGGG
ACTTTCTCATCCTGCTGCGGGTATACCTCGGCTGGCGATTCCGGGCCAACATCACCCTGACCGCGCCGAC
CCGACTGCTGGCTGTCCCGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCGTGCTGGGCGTG
GGTGATGGCGAGAGTGAGGGCGATATTCCTCAGACCTTTACCACCGAGCTGGGTACCTATACGGGCCTGC
AGCCTGCCACCTTTCTACAAGGAAACCGACGTGTTACGTATAAGTTTGACTAA