SecReT6
Protein ID: 549555032
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2925
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2979235..2981835 [-]
Productputative protease
NoteTssH
UniProt IDS5YPU8
KEGG IDkpj:N559_2925
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 218..237
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 592..757
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 220..332
AAA [PF00004], Evalue: 2.40E-20, Aligned region: 597..719
AAA_5 [PF07728], Evalue: 2.80E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 2.80E-15, Aligned region: 318..350
AAA_5 [PF07728], Evalue: 2.80E-15, Aligned region: 596..716
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 121..140
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 197..242
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 265..298
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 432..493
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 565..633
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 660..691
AAA_16 [PF13191], Evalue: 4.40E-13, Aligned region: 736..839
ClpB_D2-small [PF10431], Evalue: 8.10E-13, Aligned region: 365..388
ClpB_D2-small [PF10431], Evalue: 8.10E-13, Aligned region: 766..837
AAA_22 [PF13401], Evalue: 3.20E-09, Aligned region: 46..131
AAA_22 [PF13401], Evalue: 3.20E-09, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 3.20E-09, Aligned region: 593..618
AAA_25 [PF13481], Evalue: 4.90E-09, Aligned region: 220..296
AAA_25 [PF13481], Evalue: 4.90E-09, Aligned region: 592..625
AAA_19 [PF13245], Evalue: 3.60E-08, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 3.60E-08, Aligned region: 592..618
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 198..235
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 272..369
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 589..612
Arch_ATPase [PF01637], Evalue: 8.40E-07, Aligned region: 666..679
IstB_IS21 [PF01695], Evalue: 2.20E-06, Aligned region: 214..280
IstB_IS21 [PF01695], Evalue: 2.20E-06, Aligned region: 596..616
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 214..244
Zeta_toxin [PF06414], Evalue: 4.00E-06, Aligned region: 582..636
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 220..259
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 596..621
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 220..284
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 595..631
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 216..234
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 596..713
Clp_N [PF02861], Evalue: 5.60E-05, Aligned region: 4..40
Clp_N [PF02861], Evalue: 5.60E-05, Aligned region: 87..103
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 220..317
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 594..678
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 220..242
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 597..626
AAA_33 [PF13671], Evalue: 0.00076, Aligned region: 220..237
AAA_33 [PF13671], Evalue: 0.00076, Aligned region: 376..419
AAA_33 [PF13671], Evalue: 0.00076, Aligned region: 595..617
RNA_helicase [PF00910], Evalue: 0.00093, Aligned region: 221..242
RNA_helicase [PF00910], Evalue: 0.00093, Aligned region: 597..618
RNA_helicase [PF00910], Evalue: 0.00093, Aligned region: 694..714
RNA_helicase [PF00910], Evalue: 0.00093, Aligned region: 833..865
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 592..620
AAA_23 [PF13476], Evalue: 0.0026, Aligned region: 220..237
AAA_23 [PF13476], Evalue: 0.0026, Aligned region: 424..512
AAA_23 [PF13476], Evalue: 0.0026, Aligned region: 593..620
ResIII [PF04851], Evalue: 0.0034, Aligned region: 206..242
ResIII [PF04851], Evalue: 0.0034, Aligned region: 290..302
ResIII [PF04851], Evalue: 0.0034, Aligned region: 570..624
AAA_28 [PF13521], Evalue: 0.0044, Aligned region: 220..244
AAA_28 [PF13521], Evalue: 0.0044, Aligned region: 596..616
AAA_30 [PF13604], Evalue: 0.0083, Aligned region: 218..240
AAA_30 [PF13604], Evalue: 0.0083, Aligned region: 593..618
DUF258 [PF03193], Evalue: 0.0098, Aligned region: 207..237
DUF258 [PF03193], Evalue: 0.0098, Aligned region: 507..548
DUF258 [PF03193], Evalue: 0.0098, Aligned region: 595..608
DUF258 [PF03193], Evalue: 0.0098, Aligned region: 773..818
Protein Sequence: 866 a.a.     [Download]
>gi|549555032|ref|YP_008425870.3| putative protease [Klebsiella pneumoniae JM45]
MEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLLSWLDKQPRSVRHRPQLSD
HTLRLMQEAWLIASLSGEAQIRSVHLLMALVEKQNLIQCDGLWPLLTLGQRQLERLRSLLDAQSDERPPA
QQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALDKFTLDVTAKARDGQIDPVFGRDMEIRQMVDI
LSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVSVRTLDLGLLQAGAGVKGEFEQRLKNII
EAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRF
QMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQLPDKAVDLLDTASARLRM
SLDTVPQPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLILALDTLETQYGQELQLTE
ALLACRRDISRQAEISDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVPLSSLMKDEQTELLSLEES
LGKRVVGQEAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTETALALADALFGGEKALITINLS
EYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGVMRDGEGR
EIDFRNTVILMTANLGSDLLMQLLDEQPQASESDLHELLRPVLRGHFQPALLARFQTVIYRPLPAGALRA
IVGMKLGQVSQRLACHYGITTTLSESLFAALTEACLLPDTGARNVDSLLNQQILPALSQQLLSHMAAGQK
PRQVTLGYHEEEGVVMAFDEGTISDE
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2981835-2979235 Klebsiella pneumoniae JM45, complete genome
ATGGAGGGGGCGGCCTCCCTGTGCCAGACCCGGGCGCATGCCGAGATCCTGCCCGAGCACTGGCTGCTCA
AGCTGCTGGAACAGGGGGAAGGCGATCTGACGGTGCTGGCGCGGCGCTATGAATGGGATATGGATGCGCT
GTGGCAGGATCTGCTGAGCTGGCTGGATAAACAGCCGCGCTCGGTACGTCATCGTCCCCAGCTCTCTGAC
CATACCCTGAGGCTGATGCAGGAGGCCTGGCTGATTGCCTCTCTCAGCGGCGAAGCGCAGATCCGCAGTG
TTCACCTGCTGATGGCGCTGGTTGAAAAACAGAATCTGATCCAGTGCGATGGCCTGTGGCCGCTGTTAAC
GCTGGGCCAGCGTCAGCTGGAACGCCTGCGCTCCTTGCTGGATGCCCAGTCCGACGAACGTCCGCCAGCG
CAGCAGGAAGCGGCGCTGGCGCAGCCCCATGGCGGGGACGTGGAATTTGTGGGGCGTCCTGCGGGCAGCG
AACTGAATGCGGATGGGCTCAACCCGGCGCTGCAGAACGCGCTGGACAAATTCACTCTCGACGTCACCGC
CAAAGCCAGAGACGGCCAGATTGACCCGGTGTTCGGACGCGACATGGAAATCCGCCAGATGGTGGATATT
CTCTCCCGTCGGCGAAAAAACAACCCGATCCTCGTCGGTGAGCCGGGCGTGGGCAAGACCGCTCTGGTGG
AAGGCCTGGCGCTGCGCATTGCCGAAGGCAACGTCCCCGACGCGCTGAAGCCAGTGTCGGTGCGCACCCT
TGACCTCGGTCTGCTGCAGGCCGGCGCCGGGGTCAAAGGCGAGTTCGAGCAGCGGCTGAAAAATATCATT
GAGGCGGTACAGCAGTCGCCTTCGCCGGTGCTGCTGTTTATCGACGAGGCGCACACGATCATCGGCGCGG
GTAATCAGGCGGGCGGCGCGGATGCCGCCAACCTGCTGAAGCCGGCGCTGGCCCGGGGCGAACTGCGGAC
CATCGCCGCCACCACCTGGAGTGAATACAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGCTTT
CAGATGGTCAAGGTGGATGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCT
ATGCCGACCACCACGGCGTGCATATCACCGATGATGCGGTGCGCGCCGCCGTGACGCTGTCACGACGCTA
TCTCACCGGTCGCCAGCTGCCGGACAAGGCAGTGGATTTACTCGACACCGCTTCCGCCCGCCTGCGTATG
AGTTTGGATACCGTGCCTCAGCCGCTGACCCGCATGAAGGCGCAGCTCACCGCGCTGGCGATGGAGAAGC
AGGCGCTGCTGGAAGATATTGCGCTGGGCAACAGCGCCCGCGGCGATCGGCTGGCGGCCATTGAGCAGGA
GGAGATCCGCCTTATTCTGGCGCTGGATACCCTTGAAACTCAGTATGGTCAGGAGCTGCAGCTGACGGAA
GCGCTGCTCGCCTGCCGCCGCGATATCTCCCGCCAGGCGGAAATTAGCGATCTACAAACCGCGCTTATCG
CCGTCCAGCAGGGCAATCCGCTGCTCGGGCTGGACGTCGACGTCCGCACCGTGGCGACGGTGATTGCCGA
CTGGACCGGCGTGCCGCTCTCCTCGCTAATGAAAGATGAGCAGACGGAGCTTCTGAGTCTGGAAGAGAGT
CTCGGCAAACGGGTGGTTGGCCAGGAGGCGGCCCTGAGCGCTATTGCCCGGCGCCTGCGCGCCGCGAAAA
CCGGCCTGACGCCGGAGAACGGTCCGCAAGGGGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAAC
GGAAACGGCGCTCGCCCTGGCCGATGCGCTGTTCGGCGGCGAGAAAGCGCTGATCACCATCAATCTCTCC
GAGTACCAGGAGCCGCACACCGTCAGCCAGCTGAAGGGTTCTCCGCCGGGCTACGTCGGCTACGGCCAGG
GCGGGATCCTGACCGAGGCGGTGCGCAAACGCCCCTACAGCGTGGTGCTGCTCGATGAGGTGGAAAAGGC
CCATCGCGATGTGATGAACCTGTTCTACCAGGTCTTCGACCGGGGGGTAATGCGCGACGGCGAGGGGCGT
GAAATCGACTTTCGCAACACCGTGATCCTGATGACCGCCAACCTCGGTAGCGACCTCCTGATGCAGCTGC
TGGATGAACAGCCGCAGGCCAGCGAATCAGACCTGCACGAGCTGCTGCGCCCGGTGCTGCGCGGCCACTT
CCAGCCGGCGCTGCTGGCCCGCTTCCAGACGGTGATTTACCGTCCGCTGCCGGCGGGAGCGCTGCGCGCC
ATTGTCGGCATGAAGCTCGGGCAGGTAAGTCAGCGTCTGGCTTGCCATTACGGAATCACCACCACCCTCA
GCGAGAGCCTGTTCGCCGCGCTAACCGAGGCCTGCCTGCTGCCGGATACCGGCGCCCGCAACGTCGACAG
TCTGCTGAATCAGCAGATCCTGCCGGCGCTGAGTCAGCAGCTATTGAGCCATATGGCGGCGGGGCAGAAA
CCGCGCCAGGTGACGCTGGGGTATCACGAAGAGGAAGGCGTCGTGATGGCGTTTGACGAGGGGACAATAT
CCGATGAGTAG