SecReT6
Protein ID: 549718586
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0334
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]363397..364938 [-]
Productputative PAAR repeat-containing protein
NotePAAR
UniProt IDU4KG92
KEGG IDvni:VIBNI_B0334
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.90E-17, Aligned region: 4..43
PAAR_motif [PF05488], Evalue: 1.90E-17, Aligned region: 46..92
PAAR_motif [PF05488], Evalue: 1.90E-17, Aligned region: 59..114
DUF2974 [PF11187], Evalue: 2.20E-05, Aligned region: 301..404
DUF4150 [PF13665], Evalue: 0.00015, Aligned region: 23..45
DUF4150 [PF13665], Evalue: 0.00015, Aligned region: 64..84
Protein Sequence: 513 a.a.     [Download]
>gi|549718586|ref|YP_008641219.1| putative PAAR repeat-containing protein [Vibrio nigripulchritudo]
MPAAARLGDSCAGHGCFPATPIVAGSGDVFINGKPAARQGDTVLLHACPCPKMPHGIHGRSISAGSSTVS
INGKPASRVGDAIGCGGSVAAGSGDVFIGDTPYSSPAHKCAEGAAASKSPFLKITPLAEPLGSGWASSIF
TPEFYKSALQKMAVQADIALLNKAMELQEMSSLAQSIITAVDNGADKQEMLDVLETNTTKAQRRKAREEI
TERAKSTKPETADRFAMDMDAAEKAMLADHVYTVGKPDNKLDERRLQLRKDFEGDSGWSEASPAELKNLG
LRKKDLTIKDSNFQAQVYMPDKNVFGPSAKPVVVLRGTEMTKLDDWKNNVNQGLDKESAYYERAVQIGKK
LRKSRKPVETAGHSLGGGMSSATAKAANIEATTFNAAGLHPNTVARYGVSKAQQGPDTLIKGYRTEGDIL
TYVQEQNFLSKHVMHDAVRDKSLDTTLPKTKSLTPQAIGAATLAGVASPIYSPMAYGAVKAKEKVDMHGM
DQVRLALEERKVNDLHTLTKSGA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|549718281|ref|NC_022543.1|:c364938-363397 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGCCAGCAGCCGCTCGACTTGGAGACAGCTGTGCCGGACACGGCTGTTTTCCCGCCACACCGATTGTTG
CAGGCAGTGGCGATGTGTTCATCAACGGTAAACCTGCTGCCAGACAGGGCGATACGGTATTGCTGCACGC
CTGCCCTTGCCCCAAGATGCCTCATGGTATTCATGGCCGAAGCATTTCGGCAGGCTCTTCTACCGTTTCC
ATAAATGGAAAGCCGGCTTCTCGAGTAGGCGATGCGATTGGATGTGGTGGATCCGTTGCCGCAGGTTCTG
GTGACGTATTCATTGGGGATACCCCCTACTCCTCACCCGCACACAAATGTGCGGAAGGCGCGGCTGCAAG
CAAGTCGCCGTTTTTAAAGATAACGCCTTTGGCGGAGCCGCTGGGCAGTGGTTGGGCGAGCTCTATCTTT
ACACCTGAATTCTACAAATCTGCATTGCAGAAAATGGCAGTTCAAGCTGACATCGCACTATTGAACAAAG
CCATGGAGCTGCAAGAAATGAGTTCTCTGGCACAGTCCATTATTACGGCAGTCGACAACGGTGCAGACAA
ACAAGAAATGCTAGACGTGCTAGAAACCAACACCACGAAAGCACAGCGAAGAAAAGCGCGAGAAGAAATT
ACAGAGCGGGCAAAATCGACTAAACCAGAGACAGCAGACCGATTCGCTATGGATATGGATGCCGCTGAGA
AGGCCATGTTAGCTGACCACGTATACACAGTTGGCAAACCCGATAACAAACTAGACGAGCGGCGCTTACA
GCTAAGAAAGGACTTTGAAGGCGATTCTGGATGGTCTGAAGCATCACCTGCGGAACTCAAAAATTTAGGT
CTACGGAAAAAAGATCTGACGATTAAAGACAGTAACTTTCAAGCACAAGTATACATGCCCGACAAAAATG
TCTTTGGTCCTAGCGCCAAGCCTGTAGTGGTGTTGCGAGGCACAGAAATGACCAAACTGGATGATTGGAA
AAACAATGTAAATCAGGGTTTAGACAAAGAATCTGCCTATTACGAAAGAGCAGTCCAGATAGGGAAAAAG
CTCAGAAAGAGTCGAAAGCCAGTAGAAACAGCTGGACATTCTCTCGGTGGTGGGATGAGCAGTGCCACGG
CTAAAGCGGCCAATATTGAAGCAACGACTTTCAATGCGGCCGGTTTACACCCTAACACAGTAGCCCGTTA
CGGCGTCTCTAAAGCCCAACAAGGTCCGGATACGTTGATTAAAGGGTATCGAACGGAAGGCGATATTTTG
ACATACGTTCAAGAACAGAACTTTCTGTCAAAGCACGTTATGCACGATGCAGTTCGCGATAAATCCTTAG
ACACAACATTGCCAAAAACCAAATCCCTGACCCCTCAAGCCATAGGAGCAGCGACGTTAGCCGGTGTTGC
CTCCCCCATATACTCTCCCATGGCATATGGAGCGGTGAAAGCCAAAGAAAAGGTCGATATGCATGGAATG
GATCAGGTGCGGCTTGCCCTAGAAGAGCGTAAAGTGAACGACTTACACACACTAACTAAGAGTGGAGCTT
AA