SecReT6
Protein ID: 549718587
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0335
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]364938..366986 [-]
Productputative Rhs element Vgr protein
NoteTssI
UniProt IDU4KI58
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-64, Aligned region: 37..331
Phage_base_V [PF04717], Evalue: 2.20E-23, Aligned region: 205..215
Phage_base_V [PF04717], Evalue: 2.20E-23, Aligned region: 370..461
DUF2345 [PF10106], Evalue: 3.70E-07, Aligned region: 534..644
Protein Sequence: 682 a.a.     [Download]
>gi|549718587|ref|YP_008641220.1| putative Rhs element Vgr protein [Vibrio nigripulchritudo]
MGTLNFTLDVDGLAPDTLIVREYEGQESLSDYNHCHGFKYQIELASRQTDISPDQIVDKSAWLTIIQNGE
VTQVVHGIVRAFFKGDTGRQHTFYSLTLVPAIERLSLRQNSRIFQNQNVPDILSVLFQEMGINDYAFSLK
RSCQPREFCVQYRETDLEFMHRLAAEEGLVYRITHEVGKHTIVFSDDSQTYDELPLPVTYNALAGGQIDT
PYVFGLNERVRSDVTNVTFQEYSFKKPTYSFKQEQLGKDMAYQRDGYEHYDAPTRYKDDESGQAFSKYRL
EYLRRESHIAHGQSNHAGLQAGVKFTLTDHLDPKCNRAWIIINAVHSGTQPQALEEEGGSGATTYSNQFT
VIPAQTQWRAKPLPKPQVDGPMIAMVVGPAGEEIFCDEHGRVKVHFPWDRESSQDEHSSCWVRVSQGWAG
GQYGMIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNVTPYILPSHKTRTVLKTQTHLGEGFNELRFED
EASREQIYVHAQKDKDVVINNISRESIGLDFHQKVGQHFFQMVTENTHRLVGKNVTEEFGQDHHYKVGRN
LVQRVIGAVNRFISGGMVTKIEGGSVTSMSASEEKEIGANQRIAVNNESYLNATNIVLEAKQELTIKGPG
GFVKIDGGGITISGNVVKINEGGSPGSGTAPKAVEPQPPAKPQEPDDPDRRT
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|549718281|ref|NC_022543.1|:c366986-364938 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGGCACCTTAAATTTTACCCTAGATGTTGACGGGTTGGCTCCAGATACCCTTATCGTTCGAGAGTATG
AGGGACAAGAGTCGCTATCTGATTACAATCATTGCCATGGATTCAAATACCAGATTGAGCTGGCTAGTCG
CCAGACTGATATTTCTCCAGATCAAATCGTAGATAAAAGCGCCTGGTTAACCATCATTCAAAACGGGGAA
GTGACGCAAGTTGTACACGGCATCGTCAGAGCCTTTTTTAAAGGGGATACGGGTCGGCAGCACACGTTTT
ATTCTCTTACTTTAGTGCCAGCAATCGAACGATTATCGCTGCGCCAGAATAGCCGGATTTTTCAGAACCA
GAATGTGCCCGATATTTTGTCGGTGTTGTTTCAGGAAATGGGCATCAACGATTATGCCTTTTCCCTAAAA
CGATCCTGCCAGCCAAGGGAGTTTTGTGTTCAGTATCGCGAGACTGACCTTGAATTTATGCACCGTTTAG
CGGCTGAAGAAGGGTTGGTTTATCGAATTACTCATGAAGTAGGAAAGCACACCATTGTTTTCAGTGACGA
CAGTCAAACCTACGATGAGTTACCTCTGCCTGTTACTTACAATGCCTTGGCAGGGGGGCAGATAGATACT
CCTTATGTCTTCGGCTTAAATGAAAGAGTTCGTTCAGACGTAACGAACGTTACCTTTCAGGAATACAGTT
TTAAGAAGCCCACCTATTCCTTCAAACAAGAACAACTTGGCAAGGACATGGCGTACCAGCGTGATGGGTA
CGAACATTACGATGCGCCAACGCGCTACAAAGACGACGAAAGCGGTCAGGCATTCAGTAAATATCGTCTG
GAATACCTTCGCCGCGAATCTCATATTGCGCATGGACAAAGCAATCACGCTGGTTTGCAAGCCGGGGTTA
AATTCACGCTTACCGACCACCTTGACCCGAAATGTAATCGCGCATGGATCATAATAAATGCCGTTCACTC
AGGCACTCAGCCTCAGGCACTTGAAGAGGAAGGAGGAAGCGGAGCGACCACCTACAGTAACCAGTTTACT
GTGATTCCGGCGCAAACTCAGTGGAGAGCCAAGCCTCTGCCTAAGCCACAGGTAGACGGTCCGATGATCG
CTATGGTTGTGGGTCCTGCTGGCGAAGAGATTTTCTGCGACGAACACGGTCGCGTAAAAGTTCACTTCCC
TTGGGATCGCGAATCCTCACAAGATGAACACAGCTCGTGTTGGGTACGTGTATCTCAGGGATGGGCAGGC
GGACAATATGGCATGATCGCCATTCCACGCATTGGGCATGAAGTGATTGTTTCTTTCTTAAATGGTGACC
CTGACCAGCCGATCATTACAGGGCGCACTTATCACGCCACCAACGTAACGCCTTATATTTTGCCGAGCCA
TAAGACTCGGACGGTACTCAAAACCCAAACGCATTTGGGCGAAGGTTTTAACGAGCTGAGATTTGAAGAT
GAAGCGTCTCGCGAGCAGATCTATGTTCACGCCCAAAAAGACAAAGATGTCGTGATTAACAACATCAGTC
GCGAATCGATTGGTCTCGATTTTCACCAAAAAGTCGGTCAGCACTTCTTCCAGATGGTGACAGAAAATAC
GCACCGTTTGGTGGGTAAGAATGTGACCGAAGAGTTTGGTCAGGATCACCACTACAAAGTCGGTCGTAAC
TTAGTTCAGCGAGTCATTGGCGCAGTGAACCGTTTTATCTCTGGCGGTATGGTCACCAAAATTGAAGGGG
GCAGCGTCACGTCGATGTCTGCGTCTGAAGAAAAAGAGATCGGCGCCAACCAACGTATCGCGGTGAACAA
TGAAAGTTATCTGAATGCCACTAACATCGTACTGGAAGCCAAACAAGAACTGACTATCAAAGGCCCAGGA
GGTTTTGTCAAAATCGATGGCGGTGGGATCACCATTTCAGGAAACGTGGTGAAGATTAACGAAGGTGGTT
CGCCAGGAAGCGGCACCGCACCAAAAGCGGTTGAGCCACAGCCACCTGCGAAACCGCAAGAGCCGGACGA
TCCGGACAGGAGAACCTAA