SecReT6
Protein ID: 549718589
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0337
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]368833..369354 [+]
Producthypothetical protein
NoteTssB
UniProt IDU4K4D7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-57, Aligned region: 5..158
Protein Sequence: 173 a.a.     [Download]
>gi|549718589|ref|YP_008641222.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHPEEAPLEERKPVSIDKNNFESVMKESQ
LTLSTSVSNKLVDEDDADLPVELSFESLADFTPDSIVKQVPELSKLIELREALLALKGPLGNVPAFRSRL
QELLSSDESREKLLAELDLVASDESETSDQGNE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|549718281|ref|NC_022543.1|:368833-369354 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGTCCAAAGAAGGCAGTGTTGCCCCGAAAGAAAGAATCAATATCAAGTACATTCCTGCAACGGGCGATG
CTCAGGCAGAAGTGGAATTGCCGTTGAAAACTTTAGTGGTTGGGGACTTTAAAGGGCATCCAGAAGAAGC
CCCTTTAGAGGAACGTAAACCTGTCAGCATCGACAAGAATAACTTTGAATCTGTAATGAAAGAGAGCCAG
CTGACGCTGTCTACCTCAGTTTCAAACAAGTTAGTTGATGAAGACGACGCTGATTTACCTGTCGAATTGT
CATTTGAGTCTCTTGCAGACTTCACTCCAGACTCCATCGTCAAACAGGTTCCTGAACTAAGCAAACTGAT
CGAACTTCGCGAAGCACTACTGGCGCTGAAAGGTCCATTAGGCAACGTGCCAGCATTCCGTTCTCGTCTT
CAAGAGCTCCTGTCTTCTGATGAATCACGTGAAAAGCTGCTAGCGGAACTGGATCTTGTGGCAAGTGATG
AGAGCGAAACCTCTGATCAGGGAAATGAATAA