SecReT6
Protein ID: 549718590
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0338
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]369390..370868 [+]
Producthypothetical protein
NoteTssC
UniProt IDU4KBI1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-189, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|549718590|ref|YP_008641223.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MTTNEVAVERTIEQQPANLLDEIMAQTRIAPNEEAYDIAKKGVAAFIENLVGSNRTEEPVNKALVDQMLV
ELDKKIGAQVDEILHDDGFQNLESSWRGLKLMIDRTDFNENNKVDVLHVTKEELLDDFEFAPETTQSGLY
KHVYSSGYGQFGGEPTGVIIGNYAFTPSTPDMKLLQYMGSLGAMAHAPFISSVGPEFFGIDSFEELPNLK
DVKSTFEGPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPVKSFSYEENVSDSHESYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVYESMGALQSKIPTEVLVTDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYIKVLQREQIGAWKERQDLE
RELNGWIKQYVADQENPPADVRSRRPLRAAAIEVHDVEGEPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|549718281|ref|NC_022543.1|:369390-370868 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGACAACAAATGAAGTCGCTGTAGAAAGAACAATAGAGCAGCAGCCAGCAAATTTACTTGATGAAATCA
TGGCGCAAACCCGTATTGCACCAAACGAAGAAGCTTACGACATCGCCAAAAAAGGTGTTGCTGCTTTCAT
CGAGAATCTCGTAGGTTCAAACCGCACTGAAGAACCCGTTAACAAGGCTTTGGTTGACCAAATGCTGGTG
GAACTGGACAAAAAAATTGGTGCTCAGGTTGATGAAATTCTTCACGATGACGGTTTCCAGAATCTGGAGT
CATCGTGGCGCGGTCTTAAGTTGATGATCGACCGCACCGATTTCAACGAAAACAACAAAGTTGACGTGCT
ACACGTTACCAAAGAAGAGCTTCTGGACGACTTTGAATTCGCACCAGAGACCACTCAATCGGGTCTTTAC
AAACACGTTTACTCATCCGGTTATGGTCAGTTTGGTGGTGAGCCAACTGGCGTTATCATCGGTAACTACG
CGTTCACCCCATCTACGCCAGACATGAAACTGCTGCAATACATGGGCTCGCTTGGCGCTATGGCGCACGC
ACCATTTATCTCCAGTGTCGGTCCCGAGTTCTTTGGCATCGATTCGTTTGAAGAGCTACCGAATCTGAAA
GACGTTAAGTCTACGTTTGAAGGGCCTAAATACACCAAGTGGCGTTCACTTCGTGAATCTGAAGATGCGC
GCTACCTGGGTCTGACAGCGCCTCGCTTCTTACTTCGTGTGCCATACGATCCAACAGAAAACCCTGTGAA
GTCCTTCTCTTATGAGGAGAACGTCAGTGATTCTCACGAAAGCTACTTATGGGGTAACACAGCGTTTGCA
TTTGCCACTCGTCTGACAGACAGCTTTGCGAAATACCGCTGGTGTCCGAACATCATCGGTCCTCAAAGCG
GTGGTGCGGTGGAAGATCTTCCAGTTCACGTTTACGAATCCATGGGCGCATTGCAATCCAAGATTCCAAC
GGAAGTACTGGTCACAGACCGCAAAGAGTTCGAACTGGCGGAAGAGGGCTTCATTGCTCTGACCATGCGT
AAGGGCAGCGACAACGCCGCGTTCTTCTCTGCGAACTCAATCCAGAAACCAAAGATTTTCCCGAACACCA
AAGAAGGCAAAGAAGCCGAAACCAACTACAAGTTGGGTACTCAGTTGCCTTACATGATGATCATCAACCG
TCTTGCGCACTACATCAAAGTGCTGCAGCGCGAACAGATTGGTGCCTGGAAAGAGCGTCAGGATCTGGAG
CGTGAATTGAACGGTTGGATCAAACAATACGTGGCGGATCAGGAAAACCCACCGGCAGACGTGCGCAGCC
GTCGTCCACTTCGTGCAGCCGCTATCGAAGTGCATGACGTGGAAGGCGAGCCAGGCTGGTATCAGGTGTC
GCTATCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAACTGTCTCTGGTTGGTCGTCTGGAT
CAAGCCTAA