SecReT6
Protein ID: 549718591
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0339
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]370868..371308 [+]
Productputative Type VI secretion system, lysozyme-related protein
NoteTssE
UniProt IDU4KG94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.20E-20, Aligned region: 35..129
Protein Sequence: 146 a.a.     [Download]
>gi|549718591|ref|YP_008641224.1| putative Type VI secretion system, lysozyme-related protein [Vibrio nigripulchritudo]
MGYIAPEESVYGVSLFERLEADAKPISLSKGPDSAEVLRSIKRNVSNILNTRIGESLSSPNLGLVDFNDA
TMAMLDLSIRVKLSIKRCLEEFEPRLKEVDVMVIQDEREPLNLRFSVAATIDTSAIHERVKINLLLDNNR
KYRVVT
 
Nucleotide Sequence: 441 bp     [Download]
>gi|549718281|ref|NC_022543.1|:370868-371308 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGGATACATCGCACCTGAAGAAAGTGTGTACGGTGTCAGCCTCTTCGAGCGTTTAGAGGCTGACGCTA
AACCCATTTCACTTTCAAAAGGCCCGGACTCTGCCGAGGTATTGCGATCCATCAAGAGGAATGTGTCCAA
CATTCTGAATACCCGAATCGGAGAGTCACTGAGCTCTCCGAATCTTGGGCTGGTGGATTTTAACGATGCC
ACGATGGCGATGCTGGATCTGTCTATCCGCGTGAAACTGTCGATAAAGCGCTGCCTGGAGGAGTTTGAGC
CTCGGCTAAAAGAAGTCGACGTAATGGTCATTCAGGATGAAAGAGAGCCCCTGAACTTACGATTCAGTGT
GGCAGCGACCATAGATACATCAGCGATTCATGAAAGGGTAAAGATCAATTTACTCCTTGATAACAATAGA
AAATACCGAGTAGTAACCTAG