SecReT6
Protein ID: 549718592
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0340
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]371308..373071 [+]
Productputative Type VI secretion system, VCA0110
NoteTssF
UniProt IDU4KI61
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-193, Aligned region: 5..587
Protein Sequence: 587 a.a.     [Download]
>gi|549718592|ref|YP_008641225.1| putative Type VI secretion system, VCA0110 [Vibrio nigripulchritudo]
MAQDKYFRDELAFLKDQGKQFTEIHPQLSRFLNGRNTDPDVERLLEGFAFLTGKLREKVEDEFPELTHSI
INMLWPNYLRPIPSMSILRFSPKGNFSTRQVINKQTKVDSVPVFDTPCQFRTCRDVEIYPIVCDRISAIH
TKDASKVSLEMSMLNKDESIGSVELDSLRFYLGGDTYSAQNLYLWLGHYLDSIEVEYDGGSVKVPTDVFD
VVGFDNDGLLPYPKNVYQGYRIFQEYLAFPESFHFFDLKHIGRYIPDHVTGKFTLRFHFTQTLPGSTLVS
DESFILYATPIVNLFRHDADPIDLTGKRTEYRIAPSSRYPRHYEIFSVDHVEGWQETSDGRVRGQRRVYT
PFESFQHEIELARQRLALYYRVRVKDSIRKDGFDHHISFVRGDETTGYLLDEAVTLELTCTNRQLPAELA
VGDICVSTDTSPPFADFENITIPTQTLRPVLDGSLLWTLISNLSLNYLSLLDKNALCSVLRAYDFRSLVD
QQAARISRQRMDGIVSIESEPLDKLIKGMPVRGLLSRITMDPNAFGSEGDLYLFGTVLSQFFALYASINS
FHELVVVNAESREEYSWGNQHGMQPLI
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|549718281|ref|NC_022543.1|:371308-373071 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
GTGGCACAAGACAAATATTTCAGAGATGAGCTGGCGTTTTTAAAAGACCAAGGAAAACAGTTTACCGAGA
TTCATCCTCAACTTTCTCGCTTCTTGAATGGTCGGAATACCGATCCGGACGTCGAGCGCCTGTTGGAAGG
CTTCGCCTTTTTAACCGGTAAGCTGAGAGAGAAAGTCGAAGATGAATTTCCCGAGTTAACCCACTCGATC
ATCAACATGCTGTGGCCGAATTACCTTCGTCCTATTCCCAGCATGAGCATTCTTAGATTCAGCCCGAAAG
GCAATTTCAGTACTCGTCAGGTCATCAACAAGCAGACCAAAGTCGATTCGGTACCTGTCTTCGATACGCC
TTGCCAGTTTCGCACTTGTCGTGATGTGGAAATCTACCCGATTGTTTGCGACCGAATCTCGGCGATTCAC
ACCAAAGACGCCAGTAAAGTGTCGCTGGAAATGTCGATGCTGAACAAAGACGAATCGATAGGCTCAGTGG
AGCTGGATTCGCTCCGCTTTTATCTGGGCGGCGATACTTACAGCGCACAAAACCTCTACTTGTGGCTGGG
GCACTATCTAGATTCGATTGAAGTGGAATACGACGGCGGCAGCGTAAAAGTGCCGACTGACGTGTTTGAT
GTTGTCGGGTTTGATAACGACGGTTTACTGCCGTATCCGAAGAATGTGTATCAGGGATACCGAATTTTTC
AGGAATACCTCGCGTTTCCCGAATCGTTCCACTTCTTCGATTTGAAACACATCGGGCGTTACATTCCTGA
TCATGTGACGGGCAAGTTCACTCTTCGTTTCCACTTTACGCAGACCTTACCGGGCAGCACTTTGGTGTCG
GATGAGAGCTTCATTCTGTACGCCACGCCAATAGTCAATCTGTTCCGCCATGATGCAGATCCAATTGATT
TAACAGGCAAACGAACAGAATACCGAATTGCACCCTCCAGTCGCTACCCAAGGCACTACGAAATATTCAG
CGTCGATCACGTGGAAGGGTGGCAGGAAACCTCGGACGGAAGAGTCCGCGGTCAGCGCCGCGTATACACC
CCATTTGAAAGCTTCCAGCACGAGATAGAACTGGCTCGCCAGAGGCTGGCGCTGTACTACCGCGTTCGTG
TGAAAGACAGCATTCGCAAAGACGGCTTTGATCATCATATTTCGTTTGTCCGCGGTGACGAAACCACAGG
TTACCTGCTCGACGAAGCCGTCACGCTTGAACTGACGTGCACCAACCGACAACTGCCAGCAGAACTGGCT
GTCGGAGACATTTGTGTCAGCACGGACACATCGCCCCCATTTGCCGATTTTGAAAACATCACCATCCCAA
CACAAACCCTGCGCCCGGTACTGGATGGCAGTTTGCTGTGGACGCTGATCTCCAATTTGTCGCTGAACTA
CTTGTCGCTGCTGGACAAGAACGCGCTTTGCTCTGTGCTTCGCGCTTACGATTTCCGCTCTCTGGTGGAT
CAGCAGGCGGCGCGCATTTCGCGTCAGCGTATGGATGGCATTGTATCGATTGAATCTGAACCCCTGGACA
AGCTGATCAAAGGCATGCCTGTTCGTGGGTTGTTATCGCGAATCACCATGGACCCGAATGCGTTTGGTTC
GGAAGGGGATTTGTACCTGTTTGGCACTGTACTCAGCCAGTTCTTTGCGTTGTACGCCAGCATCAACTCG
TTCCATGAGTTAGTAGTGGTCAACGCCGAGAGTCGAGAGGAATACAGCTGGGGTAACCAGCATGGAATGC
AGCCACTGATATGA