SecReT6
Protein ID: 549718593
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0341
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]373068..374054 [+]
Producthypothetical protein
NoteTssG
UniProt IDU4KBD1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.70E-90, Aligned region: 18..315
Protein Sequence: 328 a.a.     [Download]
>gi|549718593|ref|YP_008641226.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MRSTNLEPIQDELAELDVKSFNFYQLVELLLQLNDMDPEDEDWERQCQFVFKSNPSLGFSTSDVSSLDTK
HNDRMELETTFLGLTGSQSPLPGYLLEQVLTEGEFGLRGPFLDFFNNRMITLVYRIWRKYRYYIRFQEGA
SDDFSAQLFALVGLADPDLRGETPINWCKMLSYAGMLAGRSRSPQVVSGIIAHCFDIEDVEIRQWVKRKV
DIRKNQQMELGLANMSLGENTVVGERVTECNGKFTLVLKGLSQKRFRDFLPTGKDYLPLCKVVEFVLREQ
MAYDLELQLEEGAVSAMVLDHRIDMPLGWSTFLGEGDTKQSVTIQVRQ
 
Nucleotide Sequence: 987 bp     [Download]
>gi|549718281|ref|NC_022543.1|:373068-374054 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAGATCAACCAATCTTGAGCCGATTCAGGACGAGTTGGCAGAGCTGGATGTCAAAAGCTTCAACTTCT
ATCAGTTGGTGGAGTTGCTGTTGCAACTGAACGACATGGATCCCGAGGACGAAGATTGGGAGCGCCAGTG
TCAGTTCGTGTTTAAGTCGAACCCAAGTTTAGGGTTTTCAACGTCTGATGTGTCGTCGCTCGACACCAAA
CACAACGACAGAATGGAGCTGGAAACGACGTTTCTTGGGTTAACAGGGTCTCAGTCGCCTCTTCCCGGGT
ATCTGCTGGAACAGGTGTTAACTGAGGGCGAGTTCGGCTTACGCGGACCGTTTCTCGACTTCTTCAACAA
CCGAATGATCACTCTGGTGTATCGGATTTGGCGAAAGTATCGCTATTACATTCGGTTTCAGGAAGGCGCG
AGCGATGACTTTTCCGCTCAGCTTTTCGCATTGGTGGGGTTAGCCGACCCTGATCTTCGCGGCGAAACGC
CCATCAACTGGTGCAAGATGCTTTCTTACGCCGGCATGTTGGCAGGGCGAAGCCGCTCACCACAGGTGGT
GTCAGGGATCATTGCTCACTGTTTCGATATTGAAGACGTCGAGATTCGTCAGTGGGTGAAAAGAAAAGTC
GATATTCGCAAAAACCAGCAGATGGAGCTGGGTTTAGCAAACATGAGTTTGGGTGAAAACACGGTCGTCG
GTGAACGCGTGACCGAGTGTAACGGCAAATTCACTTTGGTACTGAAAGGACTGAGCCAGAAGAGGTTTCG
CGACTTTCTACCAACAGGAAAAGATTACCTGCCACTTTGCAAAGTTGTGGAATTCGTTCTGCGAGAGCAA
ATGGCGTACGACCTGGAATTGCAGCTAGAGGAAGGCGCAGTATCTGCCATGGTACTGGATCATCGCATTG
ATATGCCTCTTGGCTGGTCCACCTTTTTAGGTGAAGGAGACACCAAACAGAGTGTCACCATTCAGGTCAG
GCAGTAG