SecReT6
Protein ID: 549718594
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0342
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]374061..375605 [+]
Productputative Type VI secretion system, FHA domain-containing protein
NoteFha
UniProt IDU4K4E0
KEGG IDvni:VIBNI_B0342
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.90E-06, Aligned region: 35..102
Protein Sequence: 514 a.a.     [Download]
>gi|549718594|ref|YP_008641227.1| putative Type VI secretion system, FHA domain-containing protein [Vibrio nigripulchritudo]
MEVEQNKRLNLMVSNTKELEPGLTPSCEFTEEGGVIGSSPSSHWILQDQRREVQGSHCEVLVYDNHFCVR
DLSGHTYVNGATMPVGKGKMAQITTKDSLKVGVYELMVVSGTSRAAMNSHNQSLDQLFTEDAALVKGDPE
SERLVALRDDVEYVDPLDVLEGGESAQEHKQLYAEEEEKLSPEQIEANRLLADEELESREKPTLQADSEY
EISSAIKLKKRSRFNPFSFFSKSEPDAPLSEPEMVTESSEAQTHSQPVENSQQANQPIESYVAGNAGAQN
EFRTEGYMMDDKTLDLLEEEIAQNEQFKAEMPLGDDNNHLLSGPLFRGLGVSVAPSHQSGDVQMTSEEIG
AALQAAVKGLLDLHQHVDDSRYGVINKNLQPIEDNPLRLGMSYEDTVKTLFNTNPGAVHLSAPSAISESL
KNLKDHNDVVQMATTLALGQIVRAFSPEVLMRRFQNYRRSYQTPEQNSDAWAWEMYQSYYKELTSDRQQG
FEKLFWEVFDQAYDRLLREKQMES
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|549718281|ref|NC_022543.1|:374061-375605 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGAAGTGGAACAGAACAAACGTTTGAACTTGATGGTGTCGAATACCAAGGAGCTGGAGCCCGGTTTAA
CGCCTTCCTGTGAGTTCACAGAGGAAGGCGGTGTGATTGGTTCCAGCCCAAGTTCGCACTGGATTTTGCA
GGATCAGCGCCGAGAAGTGCAGGGCAGCCATTGTGAAGTTTTGGTGTACGACAACCATTTCTGCGTACGC
GATCTTTCCGGTCACACCTATGTGAACGGAGCAACCATGCCTGTCGGCAAAGGGAAGATGGCGCAAATCA
CCACCAAAGATTCCCTGAAAGTAGGCGTGTATGAGTTGATGGTGGTGAGTGGCACCAGTCGCGCTGCGAT
GAACTCTCACAACCAATCACTCGATCAGCTATTTACTGAAGATGCTGCCTTAGTCAAAGGCGATCCGGAA
TCAGAAAGGTTGGTCGCGTTGCGGGACGACGTTGAATACGTCGATCCGCTTGATGTTCTGGAAGGGGGAG
AAAGCGCCCAGGAACACAAGCAACTGTACGCGGAAGAGGAAGAAAAACTTTCGCCAGAACAGATCGAAGC
CAATCGCCTTCTTGCAGATGAAGAACTGGAAAGTCGCGAAAAGCCAACCTTACAGGCAGACAGCGAATAC
GAAATTTCGTCTGCCATCAAATTGAAAAAACGAAGCCGCTTCAATCCATTTTCGTTTTTTTCCAAGTCAG
AACCCGACGCTCCTCTATCCGAGCCAGAAATGGTAACCGAGAGCAGTGAAGCGCAAACCCATTCACAGCC
AGTTGAAAACAGTCAGCAGGCTAATCAACCCATTGAATCGTACGTTGCGGGAAACGCAGGTGCGCAAAAC
GAGTTCAGAACAGAGGGCTACATGATGGACGATAAAACCCTGGATTTATTAGAAGAAGAAATCGCCCAAA
ACGAACAGTTTAAGGCAGAAATGCCGCTTGGCGATGACAATAACCACCTGTTATCGGGTCCTTTGTTCCG
TGGTTTGGGCGTGTCTGTTGCACCTTCTCACCAGTCTGGCGACGTGCAAATGACTTCAGAGGAAATCGGG
GCTGCGCTTCAGGCAGCAGTAAAAGGCCTGCTGGATTTGCACCAACATGTGGACGACAGCCGCTATGGCG
TGATCAACAAGAATCTCCAGCCGATTGAAGACAACCCACTTCGCTTGGGTATGTCTTATGAAGACACGGT
AAAAACCCTGTTCAACACCAATCCTGGTGCCGTTCATCTTTCCGCGCCATCGGCGATTTCTGAAAGCCTG
AAAAACCTCAAAGATCACAACGATGTGGTGCAAATGGCGACCACTCTGGCTCTGGGACAAATCGTTCGTG
CCTTCTCTCCAGAAGTCTTGATGCGCCGTTTCCAGAACTATCGCCGCTCTTACCAGACGCCAGAGCAAAA
TTCAGATGCGTGGGCGTGGGAAATGTACCAGAGCTACTACAAAGAGCTGACGTCGGATCGCCAGCAAGGC
TTTGAAAAACTCTTCTGGGAAGTATTCGACCAAGCGTACGACCGCTTGCTACGTGAGAAGCAGATGGAGT
CGTGA