SecReT6
Protein ID: 549718595
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0343
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]375602..376078 [+]
Productputative Type VI secretion system, lipoprotein VCA0113
NoteTssJ
UniProt IDU4KBI5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-38, Aligned region: 13..149
Protein Sequence: 158 a.a.     [Download]
>gi|549718595|ref|YP_008641228.1| putative Type VI secretion system, lipoprotein VCA0113 [Vibrio nigripulchritudo]
MIVRQVLSILLGVVLLAGCSSSENVKELPTVVSFSMVADEGVNPNVFGESSPVEVQVFELVDDSMFMSAD
FDQINEDHKKVLKSNYIQVYDYVLTPGQFKYVDDISVDEDTRYIGVLAKFAEPELSEWKKAVKIINLGRK
YHLLMLFKDYDIKLEKVE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|549718281|ref|NC_022543.1|:375602-376078 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
GTGATCGTGAGACAAGTTCTGTCCATATTGTTGGGCGTTGTGTTGTTAGCGGGGTGCAGTTCCAGCGAAA
ACGTGAAAGAACTGCCGACCGTAGTGTCATTCAGCATGGTGGCAGATGAGGGCGTAAACCCGAACGTATT
CGGCGAGTCTTCCCCTGTTGAGGTTCAGGTCTTCGAGCTGGTGGACGATTCCATGTTCATGTCAGCCGAT
TTTGACCAGATCAATGAAGACCACAAAAAAGTGCTGAAAAGCAATTACATACAGGTGTACGACTACGTGT
TAACTCCCGGGCAGTTCAAATATGTAGACGACATTTCAGTGGACGAAGACACCCGATACATCGGGGTGCT
GGCGAAGTTTGCTGAGCCAGAACTGAGTGAATGGAAAAAGGCAGTGAAGATCATCAATTTGGGTCGCAAG
TACCATTTGCTGATGCTTTTTAAAGATTACGACATCAAGTTAGAGAAGGTGGAATAG