SecReT6
Protein ID: 549718596
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0344
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]376082..377416 [+]
Producthypothetical protein
NoteTssK
UniProt IDU4KG96
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|549718596|ref|YP_008641229.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MYSRNRVVWSEGLFIKPQHFQQQQRYMEYALDERVASASQYLFGVSELSLNPEYLSFGRIAIERAVGVMP
DGTVFKIPQEDLMPEALEIADDSLANQIVYLALPLRSDSLAEISFPDSQGTGRYTARKQEVRDVHTPQGD
STVLDVSPVQPRLMLEKQDRSAFASIAIARILEKRPDGSVMLDPDFVPCHFNVVGIPHLHRFISEMSGLM
RERAKNIAQRIGSPSQGGVADVSDFMLLQSLNRLQPQLQHLSSLRSLHPERLYESLTAICGELATFTDES
RMPPQFTVYQHEMPTESFQSLMVKLRQSLSIVLEPRAVSIQLQKRRFGLMVAPIQDQSLLESADFILAVR
ARMPLEDLRRLFVQQTKVASVEKIRELISLQLPGIPVNPLPVAPRQLPYHAGYTYYQLDKTSEAWRMLQN
ASGFAFHVAGEFDELDLQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|549718281|ref|NC_022543.1|:376082-377416 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGTATTCTCGAAATAGAGTCGTGTGGAGCGAAGGATTATTCATCAAGCCACAGCATTTTCAGCAGCAAC
AACGCTACATGGAATATGCGCTGGATGAGCGAGTGGCGTCAGCAAGCCAATATCTGTTTGGGGTGTCAGA
ACTGTCTCTGAACCCAGAATACTTAAGCTTTGGTCGCATTGCGATTGAACGTGCGGTTGGCGTAATGCCA
GACGGCACGGTATTCAAAATTCCACAGGAAGATTTGATGCCCGAAGCGTTGGAGATTGCCGACGATTCAC
TGGCAAACCAGATCGTGTATCTGGCGCTTCCGCTTCGCAGTGATTCATTAGCCGAAATCAGCTTCCCGGA
TTCTCAAGGCACAGGTCGTTACACCGCGCGCAAACAAGAAGTGCGTGACGTTCATACACCGCAAGGTGAC
AGTACGGTACTGGATGTTTCACCTGTTCAGCCTCGCTTGATGCTGGAAAAGCAGGATCGCAGCGCATTTG
CTTCTATCGCCATTGCCCGAATTCTGGAAAAGAGACCCGACGGCAGCGTCATGCTGGATCCGGATTTTGT
CCCTTGCCATTTCAACGTAGTCGGCATTCCGCATTTGCACCGATTCATCAGTGAAATGTCGGGGCTGATG
CGTGAGCGTGCCAAGAACATCGCCCAGCGTATTGGCTCGCCAAGTCAGGGCGGGGTAGCTGATGTGTCAG
ACTTTATGCTGCTGCAATCGCTGAACCGACTTCAGCCACAACTGCAACATTTGTCTTCCCTGCGCAGCCT
GCATCCGGAGCGTTTGTACGAATCGCTGACCGCCATTTGCGGTGAACTGGCGACCTTTACCGATGAAAGC
CGAATGCCTCCGCAATTTACCGTGTATCAGCATGAAATGCCGACCGAGTCTTTCCAGTCTCTGATGGTGA
AATTGCGCCAGTCACTCAGCATTGTGCTCGAACCGCGTGCCGTCTCCATCCAGCTACAGAAACGTCGCTT
CGGGCTTATGGTTGCTCCAATCCAAGACCAAAGCTTGCTGGAATCGGCGGACTTTATTCTGGCGGTGCGT
GCGCGTATGCCTTTGGAAGATCTTCGTCGCCTGTTTGTGCAGCAAACCAAAGTGGCGTCGGTGGAAAAAA
TCCGCGAGCTTATCTCTCTTCAACTGCCGGGTATTCCCGTCAACCCGCTTCCTGTGGCACCAAGGCAATT
GCCTTACCACGCGGGTTACACCTACTACCAGCTAGACAAAACCAGCGAAGCATGGCGCATGCTGCAAAAC
GCCAGCGGCTTTGCCTTCCACGTCGCGGGCGAGTTCGACGAACTGGATTTGCAATTCTGGGCAATTAGGA
GCTAA