SecReT6
Protein ID: 549718597
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0345
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]377419..378198 [+]
Productputative Type IV / VI secretion system, DotU
NoteTssL
UniProt IDU4KI63
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-70, Aligned region: 39..244
Protein Sequence: 259 a.a.     [Download]
>gi|549718597|ref|YP_008641230.1| putative Type IV / VI secretion system, DotU [Vibrio nigripulchritudo]
MIVTEEFNKDRYDELLFDQVKSIDADQDYWFKLRGDNQNKMIDAATPLLGLSLRIRSLAQCDNIESIYKQ
AQEEIKAIEMELVQVDVEHAMIMAYRYVLCAVLDEAVMSTPWGADSTWAEHSLLTRFHNETWGGEKVFTI
LNRLLSDPPRYRPLLEFIYLCLMLGFEGKYKVVEGGKEERERVAIKLYETLSRLDDKEPEELTSATDHVV
ATKYRLSRQMPIWLIFAGFAGLWAVVFFVYRYMLHSKSLDVLNQLNQIL
 
Nucleotide Sequence: 780 bp     [Download]
>gi|549718281|ref|NC_022543.1|:377419-378198 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGATCGTCACTGAAGAATTCAACAAAGACCGCTACGACGAGCTGCTGTTTGATCAGGTGAAAAGCATCG
ACGCGGATCAGGATTACTGGTTCAAGCTGCGCGGCGATAACCAGAACAAAATGATCGACGCCGCTACGCC
TCTCCTAGGGCTGTCACTGCGCATCCGTTCACTGGCTCAGTGCGACAACATCGAATCCATTTACAAGCAG
GCTCAAGAAGAGATCAAAGCCATCGAAATGGAACTGGTTCAGGTGGATGTAGAACACGCGATGATCATGG
CGTACCGCTACGTGTTGTGCGCAGTGCTGGATGAAGCGGTGATGAGCACGCCTTGGGGAGCAGACAGCAC
ATGGGCAGAACATTCATTGCTGACCCGCTTTCACAACGAAACCTGGGGCGGCGAAAAAGTCTTCACCATT
TTGAACCGCTTGCTGAGCGATCCACCTCGCTATCGCCCGTTACTGGAGTTCATTTACCTCTGCCTGATGC
TCGGGTTTGAGGGTAAATACAAAGTGGTGGAAGGCGGAAAAGAAGAGCGTGAACGCGTCGCCATCAAGCT
TTATGAAACGCTTTCAAGGTTGGATGACAAAGAGCCAGAAGAGCTGACCAGCGCTACAGACCACGTGGTT
GCCACCAAATATCGCCTGAGTCGTCAGATGCCGATTTGGCTGATTTTTGCAGGCTTCGCGGGTTTGTGGG
CAGTGGTGTTTTTTGTGTACCGCTACATGCTTCACAGCAAGTCGCTCGATGTACTCAATCAGCTAAACCA
GATTCTTTAA