SecReT6
Protein ID: 549718598
SecReT6 ID856
T6SS typei1
Gene symbolclpB
Locus tagVIBNI_B0346
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]378269..380869 [+]
ProductChaperone protein clpB
NoteTssH
UniProt IDU4KBD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 220..242
AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 604..764
AAA [PF00004], Evalue: 8.30E-20, Aligned region: 222..334
AAA [PF00004], Evalue: 8.30E-20, Aligned region: 507..528
AAA [PF00004], Evalue: 8.30E-20, Aligned region: 610..744
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 771..848
AAA_5 [PF07728], Evalue: 3.00E-13, Aligned region: 222..244
AAA_5 [PF07728], Evalue: 3.00E-13, Aligned region: 609..727
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 266..300
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 483..497
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 580..648
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 678..703
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 764..804
AAA_22 [PF13401], Evalue: 7.80E-09, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 7.80E-09, Aligned region: 437..437
AAA_22 [PF13401], Evalue: 7.80E-09, Aligned region: 606..696
AAA_14 [PF13173], Evalue: 2.20E-07, Aligned region: 222..404
AAA_14 [PF13173], Evalue: 2.20E-07, Aligned region: 608..691
Arch_ATPase [PF01637], Evalue: 2.80E-06, Aligned region: 202..242
Arch_ATPase [PF01637], Evalue: 2.80E-06, Aligned region: 273..336
Arch_ATPase [PF01637], Evalue: 2.80E-06, Aligned region: 609..650
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 222..275
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 610..644
AAA_19 [PF13245], Evalue: 2.90E-05, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 2.90E-05, Aligned region: 363..399
AAA_19 [PF13245], Evalue: 2.90E-05, Aligned region: 606..632
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 276..317
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 499..545
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 603..642
NACHT [PF05729], Evalue: 0.00013, Aligned region: 222..250
NACHT [PF05729], Evalue: 0.00013, Aligned region: 610..636
MobB [PF03205], Evalue: 0.00016, Aligned region: 222..244
MobB [PF03205], Evalue: 0.00016, Aligned region: 609..637
DUF258 [PF03193], Evalue: 0.00023, Aligned region: 189..241
DUF258 [PF03193], Evalue: 0.00023, Aligned region: 609..649
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 222..260
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 467..496
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 610..642
DUF815 [PF05673], Evalue: 0.00042, Aligned region: 218..297
DUF815 [PF05673], Evalue: 0.00042, Aligned region: 347..389
DUF815 [PF05673], Evalue: 0.00042, Aligned region: 602..642
AAA_29 [PF13555], Evalue: 0.0008, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.0008, Aligned region: 605..620
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 223..244
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 610..632
AAA_11 [PF13086], Evalue: 0.0018, Aligned region: 374..491
AAA_11 [PF13086], Evalue: 0.0018, Aligned region: 606..631
Sigma54_activat [PF00158], Evalue: 0.0029, Aligned region: 220..240
Sigma54_activat [PF00158], Evalue: 0.0029, Aligned region: 607..707
DUF2075 [PF09848], Evalue: 0.0029, Aligned region: 222..324
DUF2075 [PF09848], Evalue: 0.0029, Aligned region: 609..642
Miro [PF08477], Evalue: 0.003, Aligned region: 223..244
Miro [PF08477], Evalue: 0.003, Aligned region: 610..632
AAA_33 [PF13671], Evalue: 0.0038, Aligned region: 2..71
AAA_33 [PF13671], Evalue: 0.0038, Aligned region: 222..240
AAA_33 [PF13671], Evalue: 0.0038, Aligned region: 468..546
AAA_33 [PF13671], Evalue: 0.0038, Aligned region: 610..630
Zeta_toxin [PF06414], Evalue: 0.0051, Aligned region: 222..242
Zeta_toxin [PF06414], Evalue: 0.0051, Aligned region: 594..649
IstB_IS21 [PF01695], Evalue: 0.0052, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0052, Aligned region: 608..623
Ras [PF00071], Evalue: 0.0056, Aligned region: 222..236
Ras [PF00071], Evalue: 0.0056, Aligned region: 610..651
Clp_N [PF02861], Evalue: 0.0057, Aligned region: 24..58
Protein Sequence: 866 a.a.     [Download]
>gi|549718598|ref|YP_008641231.1| Chaperone protein clpB [Vibrio nigripulchritudo]
MIRIELPTLISKLNDQSKLALEQAASLCLEHEHSEVTFEHYLHVLLDNPLSDVREILRSGNTDHHEVQDL
VHGAFPRETGHDTYPVFSPLLIELLQDAWLLASTEMNLDHLRSGVIFLTAIMRPDRYLPLPLANKLQSLN
RETLRREFFNILKDSSETPVEESTGKKSKAPVGNDGQRALDKYCANVTAQARNQELDPVLCRDEEINLMI
DILCRRRKNNPIVVGDAGVGKSAVVEGLANRIVDGKVPDKLKNIELMSLDLGLLQAGAAVKGEFEKRLKS
IIDEVKSSPTPIILFIDEAHTLIGAGNQEGGGDAANLLKPALARGELCAVAATTWKEYKKYFEKDPALSR
RFQLVKLDEPSADQTVDILRGLCEVYEKNHQVLISDSALKAASHLSARYVSGRQLPDKAIDVLDTACARI
SINLSTPPSRMSELETLQHQYELERRMLERQVQIGQKIDEERLATLIAKDEECKAEYQETEQAWQKQRDL
INEMIKLRTTLLSDDQSEDDLAETKQALEALYEQLDQTPFKDRLIHPEVDEQQVAEVIADWTGVPIDQMN
TDELTKLTHLPEILENAIKGQDVAINRIHKHLLTARADLRRPGRPKGAFLLVGPSGVGKTETVVQLAEEL
YGGKRFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRKMPYSVVLLDEVEKAHPEVLNLFYQ
AFDKGELADGEGRLIDCQNIVFFLTSNLGFQTIVDYAERTDEMDDALYPELAAFFKPALLARMETVPYLP
LGEEVMEKIVRGKLSKLETTLTERYKATVDIASSVIEEILSRTTRSENGARMLEAIIEGQMLPPISLALL
EKLANQETVTHIAISAEDGEFIGKVE
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|549718281|ref|NC_022543.1|:378269-380869 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
GTGATTCGAATCGAACTTCCTACATTAATCAGTAAACTGAACGACCAAAGCAAACTGGCTCTGGAGCAAG
CTGCCTCACTGTGCCTTGAACACGAACACTCCGAAGTGACGTTCGAGCACTACTTGCATGTGTTACTGGA
CAATCCACTCAGTGATGTGCGCGAAATTCTGCGCAGCGGCAATACAGACCATCACGAAGTTCAGGATTTG
GTGCATGGCGCGTTTCCGCGTGAAACGGGGCACGATACTTATCCGGTTTTCTCGCCATTGCTGATTGAAT
TGCTGCAAGATGCCTGGTTGTTGGCATCGACGGAAATGAATCTGGACCACCTCCGCTCCGGTGTAATTTT
CCTGACCGCCATCATGCGTCCGGATCGCTATCTGCCGTTGCCTTTGGCGAACAAACTCCAGTCTTTGAAT
CGCGAGACCCTTCGCCGTGAGTTCTTCAACATTTTGAAAGACTCTTCTGAAACTCCGGTTGAAGAAAGTA
CAGGTAAGAAAAGCAAAGCACCTGTCGGCAACGACGGTCAGCGTGCGCTCGATAAATACTGCGCAAACGT
CACTGCGCAAGCGCGCAATCAGGAACTTGACCCTGTGCTGTGCCGAGATGAAGAGATCAATCTGATGATC
GACATCCTCTGCCGTCGCCGCAAGAACAACCCGATTGTAGTGGGTGATGCTGGTGTCGGTAAAAGTGCGG
TGGTTGAAGGTTTAGCCAATCGCATTGTGGACGGAAAGGTGCCCGATAAGCTGAAAAACATTGAACTGAT
GAGCTTAGATTTGGGCTTGCTGCAAGCGGGGGCTGCGGTAAAAGGCGAGTTTGAAAAGCGCCTTAAATCC
ATTATTGATGAAGTGAAATCGTCGCCAACGCCGATCATTCTGTTCATCGACGAAGCACACACGCTGATTG
GAGCGGGCAACCAAGAAGGGGGAGGCGATGCCGCCAACCTGTTGAAGCCTGCGCTGGCGCGTGGCGAATT
GTGCGCCGTGGCTGCCACTACCTGGAAAGAATACAAGAAATACTTCGAAAAAGATCCTGCTCTGAGTCGT
CGTTTCCAACTGGTGAAGCTGGATGAACCGTCTGCGGATCAAACTGTCGATATCCTTCGCGGCTTGTGCG
AAGTGTATGAGAAGAATCATCAGGTTCTGATTTCAGACAGCGCATTAAAAGCCGCGTCGCACCTTTCTGC
TCGCTACGTTTCGGGCAGACAACTGCCGGACAAAGCAATTGACGTACTTGATACCGCGTGTGCGCGTATC
TCTATCAATCTGAGTACGCCGCCATCTCGCATGTCCGAGCTGGAAACCTTACAGCATCAATACGAGTTAG
AGCGTCGCATGCTAGAGCGTCAGGTTCAGATTGGTCAGAAAATAGATGAAGAGCGTCTTGCCACATTGAT
CGCCAAAGACGAAGAGTGCAAAGCTGAATATCAGGAAACCGAACAAGCCTGGCAGAAACAGCGCGATTTG
ATCAACGAGATGATCAAACTGCGAACAACATTGCTCAGTGATGACCAGTCGGAAGACGACCTTGCAGAGA
CCAAGCAAGCATTAGAAGCTCTATACGAACAGCTTGATCAAACCCCTTTCAAGGATCGTCTGATTCACCC
AGAAGTTGACGAACAGCAGGTTGCGGAAGTGATTGCCGACTGGACTGGAGTGCCAATTGATCAAATGAAT
ACCGATGAGCTGACCAAGCTGACGCACCTTCCAGAGATTCTGGAGAACGCCATCAAAGGTCAGGATGTCG
CCATCAATCGCATTCACAAACACCTGCTGACCGCTCGTGCCGATTTAAGACGCCCAGGAAGACCAAAGGG
CGCCTTCCTATTAGTCGGACCAAGTGGTGTGGGTAAAACCGAAACCGTGGTGCAACTGGCAGAAGAGCTG
TACGGCGGTAAACGCTTCCTGACCACCATCAATATGTCGGAATATCAAGAGAAGCACACAGTCTCCAGAC
TGATTGGTTCGCCTCCGGGCTATGTAGGCTTTGGTGAAGGCGGTGTGCTGACTGAAGCGATTCGCAAGAT
GCCGTATTCAGTCGTGTTGCTGGATGAAGTGGAGAAAGCCCATCCAGAAGTGCTAAACCTGTTCTATCAG
GCGTTCGACAAGGGTGAACTGGCGGATGGAGAAGGTCGTTTGATTGACTGCCAGAACATTGTGTTCTTCC
TGACGTCTAACCTTGGCTTCCAGACCATTGTTGATTACGCCGAGCGCACCGACGAAATGGACGACGCGCT
CTACCCAGAGCTGGCGGCATTCTTCAAACCGGCTTTGCTCGCCCGTATGGAAACGGTGCCGTATCTGCCG
CTGGGTGAAGAGGTGATGGAGAAGATTGTTCGCGGCAAGCTGAGCAAGCTCGAAACCACCTTAACCGAAC
GCTACAAAGCGACGGTCGATATTGCTTCCAGCGTGATCGAAGAAATCCTTTCCCGAACTACACGTTCAGA
AAATGGCGCTCGCATGCTTGAAGCCATCATCGAAGGGCAGATGTTACCACCCATTTCTCTGGCGTTACTT
GAGAAACTGGCGAACCAAGAGACTGTTACTCACATAGCCATTTCTGCCGAAGACGGCGAATTCATCGGGA
AGGTGGAATAG