SecReT6
Protein ID: 549718603
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0351
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]388173..389498 [+]
Productputative ATPase involved in DNA repair/Chromosome segregation
NoteTssA
UniProt IDU4KBE0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-05, Aligned region: 46..92
ImpA-rel_N [PF06812], Evalue: 2.10E-05, Aligned region: 143..155
Protein Sequence: 441 a.a.     [Download]
>gi|549718603|ref|YP_008641236.1| putative ATPase involved in DNA repair/Chromosome segregation [Vibrio nigripulchritudo]
MSNKIYIDHGIFTILSNQPSLRDSERYQKIRSEINGRMGFLSGATQWESVFNECIKLGTEVGMDFLLTSY
FSVAGFKVEGVKGFASGLELMLAAYVEDKDHQALSSHHKQEIIQWMTSKVTSDLKLIKPNKDQIRDLYRC
ERALQDLNELCERFQPESSPNFEGIAFSIFEHIDRIETVTQVVQKPDLPTDNTSKSGRNIWMFFFVLAWA
LTVAVAYFYSVERLKVCHAVEGMKRTVTAPTEELLSKLTEESVAELPPDEQIVIRSALVDAMDSDLKITV
YQQYLNVVMLMEKAKELFPDNPEVEAAIKKIEVQSQGYREELQRDLERFYSARTLAANLVNETKHANNQE
SAERLEQYILSLSPIYSRNAYIQEQIDKQNYDLAKEELSVLQERVARIVWQLSSYQNALSDVAHDPVVAV
KSSEEIVIEEPGAQPLPGAQP
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|549718281|ref|NC_022543.1|:388173-389498 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
GTGTCAAACAAGATTTATATCGACCACGGAATTTTTACCATACTGAGCAACCAGCCTTCGCTCAGGGATT
CCGAACGCTATCAAAAAATTCGCAGTGAAATTAATGGTCGAATGGGATTTTTATCTGGGGCGACTCAGTG
GGAATCCGTGTTTAATGAATGCATCAAACTCGGCACCGAAGTGGGAATGGACTTCCTGCTTACTAGCTAC
TTTTCAGTTGCAGGGTTTAAAGTTGAGGGAGTGAAAGGCTTTGCATCGGGGTTAGAGCTGATGCTTGCCG
CCTATGTGGAAGACAAAGATCATCAGGCACTTTCAAGCCATCACAAGCAAGAAATCATTCAGTGGATGAC
CAGCAAGGTCACGTCTGATCTCAAACTGATCAAGCCCAATAAGGACCAGATTCGTGACCTGTATCGCTGT
GAGCGTGCTTTGCAGGATCTCAATGAGCTGTGCGAGCGTTTTCAGCCTGAATCCAGCCCGAATTTCGAAG
GCATTGCCTTTAGTATTTTCGAGCATATTGACCGTATCGAAACCGTAACTCAAGTGGTTCAGAAGCCAGA
TTTGCCAACCGACAATACCAGTAAGTCTGGTCGGAATATCTGGATGTTTTTCTTTGTCCTTGCATGGGCA
TTAACGGTTGCGGTGGCTTACTTTTACTCGGTTGAGCGTTTAAAGGTGTGCCACGCCGTAGAAGGCATGA
AGCGCACTGTGACTGCCCCAACGGAAGAGCTGCTTTCAAAGCTGACCGAGGAGTCGGTTGCCGAGCTGCC
ACCTGATGAACAAATTGTGATTCGCTCTGCATTGGTGGATGCCATGGACAGCGATTTGAAGATCACGGTT
TACCAGCAATACCTCAACGTTGTCATGTTGATGGAAAAAGCCAAAGAACTGTTCCCGGATAACCCGGAAG
TGGAAGCCGCAATCAAGAAAATTGAGGTACAAAGCCAAGGGTATCGTGAAGAGTTACAACGCGATTTAGA
GCGTTTCTATTCTGCAAGAACACTGGCAGCGAATCTGGTGAATGAAACCAAGCACGCAAATAATCAGGAA
AGCGCCGAGCGACTGGAGCAGTACATTTTAAGCCTGTCGCCAATCTATAGTCGCAACGCTTATATTCAGG
AACAAATCGATAAGCAAAACTACGATCTCGCTAAAGAAGAGCTGTCGGTATTGCAGGAACGCGTCGCCCG
GATCGTGTGGCAATTGTCCTCTTATCAAAATGCGCTTTCTGATGTCGCTCATGATCCGGTCGTTGCAGTT
AAGAGCAGTGAAGAAATTGTCATTGAAGAGCCAGGTGCCCAACCATTACCAGGTGCTCAGCCATGA