SecReT6
Protein ID: 549722986
SecReT6 ID857
T6SS typei3
Gene symbolsciD
Locus tagSTMDT2_02641
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]308611..309105 [-]
Productvirulence associated protein
NoteTssE
UniProt IDU4M9D1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|549722986|ref|YP_008643176.1| virulence associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|549722728|ref|NC_022544.1|:c309105-308611 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGCCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA